KEGG   Serratia proteamaculans: Spro_0595Help
Entry
Spro_0595         CDS       T00595                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
spe  Serratia proteamaculans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Spro_0595
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Spro_0595
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Spro_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
659812..660582
Genome map
AA seq 256 aa AA seqDB search
MNLQGKTALVTGSTSGIGLGLAASLAAAGAQVILNGFGEVEQAKAHIAGLGVAPGYHDAD
LSDPQQIADLMRYVELEFGGTDILVNNAGIQHVSPLESFPADKWNAIIAINLSSVFHTSR
LALPGMRERGWGRIINVASVHGLVASKDKAAYVAAKHGVVGLTKTIALETARSAITCNAI
CPGWVLTPLVQQQIDQRIAAGTDPQQARNDLLAEKQPSLEFVTPEQLGELALFLCSDAAV
QVRGAAWNMDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaggcaaaacggcactggtgaccggttcgaccagcggtatcggcctcggg
ctggccgccagcctggcggccgcgggcgcccaggtgatcctcaacggttttggcgaggtg
gagcaggcgaaggcacatatcgcaggtttgggcgtcgcgcccggctaccacgacgcagat
ctcagcgatccgcaacagatcgccgatctgatgcgttatgtcgagctggagtttggtggc
accgacattctggttaataacgccgggattcagcatgtttcacccctggagtcattcccg
gccgacaaatggaacgcgattatcgcgattaatctgtcgtcggtgttccacaccagccgc
ctggcactgccgggtatgcgagagcgcggttggggacggattatcaacgttgcctcggtg
catgggttggtggcatccaaagacaaggcggcctatgtggcggccaaacacggcgtggtg
gggctgaccaaaaccatcgcgctggaaaccgcgcgtagcgccattacctgcaacgccatc
tgtcccggttgggtgctgacgccgttggtgcagcagcaaattgaccaacggattgccgcc
ggcaccgatccacagcaggcgcgcaatgacctgctggcggagaaacagccctcgctggag
tttgtgacgccggagcagttgggggaactggcgctgtttctgtgcagcgacgccgcagtg
caggtgcgcggtgccgcctggaatatggatggcggctggttggcgcagtaa

DBGET integrated database retrieval system