KEGG   Serratia proteamaculans: Spro_0650Help
Entry
Spro_0650         CDS       T00595                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
spe  Serratia proteamaculans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Spro_0650
   00240 Pyrimidine metabolism
    Spro_0650
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Spro_0650
   03430 Mismatch repair
    Spro_0650
   03440 Homologous recombination
    Spro_0650
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Spro_0650
DNA replication proteins [BR:spe03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Spro_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
715586..716023
Genome map
AA seq 145 aa AA seqDB search
MASKRDWLLQQLGITQWTLRRPGVLQGEVAVSLPPEVRLLVVAQALPEHNDPLFCDVLRS
LGLTPAQTYSLTPDQVAMLPEDTECNSWRLGVAEPLAVAGAQLYSPALAELSLDASAKRA
LWQQICHHEQDFYPDRGRPGHSLQD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaacgcgactggctgttacaacaactgggtattacgcagtggacattgcgc
cgcccgggcgtgttgcagggcgaagtagcggtcagcctgccacccgaggtgcgtttactg
gtcgtggcgcaggccttgcctgagcataacgatccgctgttttgcgacgtgctgcgcagc
ctgggcctgaccccggcgcaaacctatagcctgacgccggatcaggtggctatgttgcct
gaggataccgaatgcaacagttggcggttgggcgttgcggagccgcttgcggtggccggc
gcgcagctatacagcccggcactggccgagctttctctcgatgcgagtgccaaacgcgca
ctctggcagcagatttgtcatcatgaacaagatttctaccctgaccgcggccgacctggc
cacagccttcaagattga

DBGET integrated database retrieval system