KEGG   Serratia proteamaculans: Spro_0944Help
Entry
Spro_0944         CDS       T00595                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
spe  Serratia proteamaculans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:spe00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1041891..1042433
Genome map
AA seq 180 aa AA seqDB search
MSGLTIFSDQEPQQPLWQSRDAQAIGQQLAQIGVRFERWQADRELGENPDPAVVIAAYQH
QIDRLVAEKGYQSWDVISMRPDNAQREVLRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
KIFQILCEKNDLISVPANTRHWFDMGSAPNFTAIRVFDNPEGWVAHFTGDNIADAYPRLD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattgaccattttcagcgatcaagagccgcaacagccgctgtggcagagccgt
gacgcgcaggccattgggcagcaactggcacagattggcgtacgttttgaacgctggcag
gcggatcgtgaactgggtgaaaacccggatccggccgtcgtgatcgccgcctatcagcat
cagatcgaccggctggtggcggagaagggctaccagagttgggatgtgatcagcatgcgt
ccggataatgcccagcgcgaagtgttgcgcagcaagtttctgtccgagcatacccacggc
gaagatgaagtgcgtttctttgtcgagggggccgggctgttctgcctgcatctggatggc
aagatcttccagatcctgtgtgagaagaacgatctgatctcggtaccggccaatacccgt
cattggttcgatatgggctcagcaccgaatttcactgcgatccgcgtgtttgataacccg
gaaggctgggtggcgcatttcaccggcgataacatcgccgatgcctacccgcgtctcgac
tga

DBGET integrated database retrieval system