KEGG   Serratia proteamaculans: Spro_0967Help
Entry
Spro_0967         CDS       T00595                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spe  Serratia proteamaculans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spro_0967
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Spro_0967
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Spro_0967
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Spro_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1064828..1065931
Genome map
AA seq 367 aa AA seqDB search
MNGSQTLVVKLGTSVLTGGSLRLNRAHIVELVRQCAQQHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADLEDRERFLNARDT
MTALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLYTADPR
NNPQAELIREVHGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDVIIAAGSKPG
VVADVIEGKPVGTRFHALETPLENRKRWIFGAPPAGEITVDDGAVDAIMARGSSLLPKGI
REVKGDFSRGEVIRIRNLTGRDLAHGVSRYNSDAMRMIAGHHSQEISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagccagacactggttgtgaaattgggcaccagcgtgttgaccggcggatcg
ctgcgtcttaaccgtgcccatattgtcgaactggttcgccagtgcgcacaacagcatgca
gcgggtcaccgcatcgttatcgtcacctccggcgcgattgccgccgggcgcgaacatttg
ggttaccccgaactccccgccaccatcgcctccaagcagttgctggcggcggtcgggcag
agccggttgatccaactgtgggagcaactgttctccatttacggtatccacgtcgggcag
atgttgctgacgcgtgccgatctggaagaccgcgaacgcttcctcaatgcgcgtgacacc
atgacggcgttgctggacaaccgtatcgtgccggtaatcaatgagaacgacgcggtagcg
accgcagaaatcaaggtcggcgacaacgacaacctgtcggcattggcggcaatcctggcc
ggggccgacaaactgttgttgctgaccgatcagcaggggctgtacaccgccgacccacgt
aacaacccgcaggcagagctgatccgtgaagtgcacggcatcgacgacgccttgcgcgcc
atcgccggcgacagcgtttccggtctgggcaccggcggcatgggcaccaagctgcaagcc
gccgacgtggcctgccgcgccggtatcgacgtaatcatcgccgccggcagcaagccgggc
gtggtggctgacgtgattgaaggcaaaccggtgggcacccgtttccacgcgctggaaacc
ccgctggaaaaccgcaaacgctggatcttcggcgcaccaccggccggtgagatcaccgtc
gacgacggtgcggtcgacgccattatggcgcgcggcagctcactgctgccgaagggcatc
cgcgaggtcaaaggcgatttctcccgtggtgaagtgatccgcatccgcaacctgacgggg
cgcgatctggcgcacggcgtcagccgttataacagcgacgcgatgcgcatgattgccggt
caccactcgcaggaaatcagcgaaattctcggttatgaatacggcccggtggcagttcac
cgcgacgatatgattgtcagctaa

DBGET integrated database retrieval system