KEGG   Serratia proteamaculans: Spro_1268Help
Entry
Spro_1268         CDS       T00595                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spe  Serratia proteamaculans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_1268
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spro_1268
  Amino acid metabolism
   00310 Lysine degradation
    Spro_1268
Enzymes [BR:spe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Spro_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1395290..1396504
Genome map
AA seq 404 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAI
VEEEGATVLSRQILGRIRPGDSSGKPTEEKSQAKEATPAQRATASLEEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEAHLANGKKADKPAAVEAAPQPALSGRSEKRVPM
TRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDMRKQYGEAFEKRHGVRLGFMSFYIKA
VVEALKRFPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDVDSMSMADIEKKIKE
LAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVKGQ
VVILPMMYLALSYDHRLIDGKESVGYLVTVKEMLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcctgaccttcctgaatcggttgccgatgcgaccgtc
gccacctggcacaagaaaccaggtgacagcgtccagcgtgacgaagttctggttgaaatc
gaaactgacaaagtggtgctggaagttccggccagcgaagcaggcattctggatgcgatc
gtggaagaagagggcgcaaccgtgctttctcgccagatccttggccgtattcgtccgggc
gacagctctggcaagccgaccgaagaaaaaagccaggctaaagaagccactccagcccag
cgcgcaaccgccagcctggaagaagagagcaacgacgcactcagcccggctatccgccgc
ctgattgccgagcatgacctcgatgcagctgccatcaaaggcagcggcgtgggtggccgt
atcacccgcgaagacgtggaagcgcacctggccaacggcaagaaagccgacaagccggcc
gccgttgaagccgctccgcagcctgctctgagcggtcgcagcgagaagcgtgttcctatg
acccgtctgcgcaagcgcgtggccgagcgcctgttggaagcgaagaacagcactgcgatg
ctgacgaccttcaacgaaatcaacatgcagccgatcatggacatgcgcaagcagtacggt
gaagccttcgaaaaacgccacggtgtacgtctgggcttcatgtccttctacatcaaggcg
gtagttgaagcgctgaaacgcttcccggaagtgaacgcttctatcgacggcaccgacgtg
gtgtaccacaactatttcgatatcagcattgcggtatctactcctcgtggcctggtgacc
ccggtgctgcgcgatgtagacagcatgagcatggcggacatcgagaagaaaatcaaagag
ctggcagtcaaaggccgtgatggcaaattgactgtggaagagctgaccggcggtaacttc
accattaccaacggcggcgtattcggttcactgatgtctaccccgatcatcaacccaccg
cagagcgccatcctgggcatgcacgccattaaagatcgcccaatggcggtcaaaggccag
gttgtgatcctgccgatgatgtatctggcactgtcttatgaccatcgcctgatcgacggt
aaagaatccgtgggttacctggtgacggttaaagagatgctggaagatccggctcgtctg
ctgctggacgtataa

DBGET integrated database retrieval system