KEGG   Serratia proteamaculans: Spro_1268Help
Entry
Spro_1268         CDS       T00595                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spe  Serratia proteamaculans
Pathway
spe00020  Citrate cycle (TCA cycle)
spe00310  Lysine degradation
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
Module
spe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Spro_1268
  Amino acid metabolism
   00310 Lysine degradation
    Spro_1268
Enzymes [BR:spe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Spro_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABV40372
JGI: Spro1268
UniProt: A8GB82
Position
1395290..1396504
Genome map
AA seq 404 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPASEAGILDAI
VEEEGATVLSRQILGRIRPGDSSGKPTEEKSQAKEATPAQRATASLEEESNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEAHLANGKKADKPAAVEAAPQPALSGRSEKRVPM
TRLRKRVAERLLEAKNSTAMLTTFNEINMQPIMDMRKQYGEAFEKRHGVRLGFMSFYIKA
VVEALKRFPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDVDSMSMADIEKKIKE
LAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVKGQ
VVILPMMYLALSYDHRLIDGKESVGYLVTVKEMLEDPARLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcctgaccttcctgaatcggttgccgatgcgaccgtc
gccacctggcacaagaaaccaggtgacagcgtccagcgtgacgaagttctggttgaaatc
gaaactgacaaagtggtgctggaagttccggccagcgaagcaggcattctggatgcgatc
gtggaagaagagggcgcaaccgtgctttctcgccagatccttggccgtattcgtccgggc
gacagctctggcaagccgaccgaagaaaaaagccaggctaaagaagccactccagcccag
cgcgcaaccgccagcctggaagaagagagcaacgacgcactcagcccggctatccgccgc
ctgattgccgagcatgacctcgatgcagctgccatcaaaggcagcggcgtgggtggccgt
atcacccgcgaagacgtggaagcgcacctggccaacggcaagaaagccgacaagccggcc
gccgttgaagccgctccgcagcctgctctgagcggtcgcagcgagaagcgtgttcctatg
acccgtctgcgcaagcgcgtggccgagcgcctgttggaagcgaagaacagcactgcgatg
ctgacgaccttcaacgaaatcaacatgcagccgatcatggacatgcgcaagcagtacggt
gaagccttcgaaaaacgccacggtgtacgtctgggcttcatgtccttctacatcaaggcg
gtagttgaagcgctgaaacgcttcccggaagtgaacgcttctatcgacggcaccgacgtg
gtgtaccacaactatttcgatatcagcattgcggtatctactcctcgtggcctggtgacc
ccggtgctgcgcgatgtagacagcatgagcatggcggacatcgagaagaaaatcaaagag
ctggcagtcaaaggccgtgatggcaaattgactgtggaagagctgaccggcggtaacttc
accattaccaacggcggcgtattcggttcactgatgtctaccccgatcatcaacccaccg
cagagcgccatcctgggcatgcacgccattaaagatcgcccaatggcggtcaaaggccag
gttgtgatcctgccgatgatgtatctggcactgtcttatgaccatcgcctgatcgacggt
aaagaatccgtgggttacctggtgacggttaaagagatgctggaagatccggctcgtctg
ctgctggacgtataa

DBGET integrated database retrieval system