KEGG   Serratia proteamaculans: Spro_1288Help
Entry
Spro_1288         CDS       T00595                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spe  Serratia proteamaculans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_1288 (gpmA)
   01230 Biosynthesis of amino acids
    Spro_1288 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_1288 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Spro_1288 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spro_1288 (gpmA)
Enzymes [BR:spe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spro_1288 (gpmA)
Exosome [BR:spe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spro_1288 (gpmA)
  Exosomal proteins of melanoma cells
   Spro_1288 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1417448..1418200)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGELLKNEGFAFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYSALTEQELPLTESLALTIDRVIPYWDEEILPRIKSGERVI
VAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgtcacggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtatgatgttgatttgtctgagaaaggccgcaccgaagcgaaagct
gcaggcgaactgttgaaaaacgaaggtttcgcttttgactttgcttacacttccgtactc
aagcgtgctatccacaccctgtggaacattctggacgaactggatcaagcctggctgccg
actgaaaaatcctggaaactgaacgaacgtcactacggcgcgttgcagggtctgaacaag
gctgaaaccgcagaaaaatacggtgacgagcaggttaagcaatggcgtcgcggttttgcc
gtaacaccaccagagctgaccaaagatgacgagcgctacccaggccacgacccacgttac
tccgcgctgaccgagcaagagctgccgctgaccgaaagcctggcgctgaccatcgatcgc
gtgatcccttactgggatgaagaaatcctgccacgtatcaaaagcggcgagcgcgttatc
gttgcggctcacggcaactccctgcgtgcgctggtgaaatacctggataacctgagcgaa
gacgagatcctcgaactgaacatcccaaccggcgtgccgttggtgtatgagttcgacgag
aacttcaagccaatcaaacgttactacctgggcaatgccgacgagatcgctgctaaagcg
gccgccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system