KEGG   Serratia proteamaculans: Spro_1288Help
Entry
Spro_1288         CDS       T00595                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spe  Serratia proteamaculans
Pathway
spe00010  Glycolysis / Gluconeogenesis
spe00260  Glycine, serine and threonine metabolism
spe00680  Methane metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
spe01230  Biosynthesis of amino acids
Module
spe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spe_M00002  Glycolysis, core module involving three-carbon compounds
spe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_1288
  Energy metabolism
   00680 Methane metabolism
    Spro_1288
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spro_1288
Enzymes [BR:spe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Spro_1288
Membrane trafficking [BR:spe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Spro_1288
Exosome [BR:spe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Spro_1288
  Exosomal proteins of melanoma cells
   Spro_1288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABV40392
JGI: Spro1288
UniProt: A8GBA2
Position
complement(1417448..1418200)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGELLKNEGFAFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYSALTEQELPLTESLALTIDRVIPYWDEEILPRIKSGERVI
VAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgtcacggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtatgatgttgatttgtctgagaaaggccgcaccgaagcgaaagct
gcaggcgaactgttgaaaaacgaaggtttcgcttttgactttgcttacacttccgtactc
aagcgtgctatccacaccctgtggaacattctggacgaactggatcaagcctggctgccg
actgaaaaatcctggaaactgaacgaacgtcactacggcgcgttgcagggtctgaacaag
gctgaaaccgcagaaaaatacggtgacgagcaggttaagcaatggcgtcgcggttttgcc
gtaacaccaccagagctgaccaaagatgacgagcgctacccaggccacgacccacgttac
tccgcgctgaccgagcaagagctgccgctgaccgaaagcctggcgctgaccatcgatcgc
gtgatcccttactgggatgaagaaatcctgccacgtatcaaaagcggcgagcgcgttatc
gttgcggctcacggcaactccctgcgtgcgctggtgaaatacctggataacctgagcgaa
gacgagatcctcgaactgaacatcccaaccggcgtgccgttggtgtatgagttcgacgag
aacttcaagccaatcaaacgttactacctgggcaatgccgacgagatcgctgctaaagcg
gccgccgtggcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system