KEGG   Serratia proteamaculans: Spro_1553Help
Entry
Spro_1553         CDS       T00595                                 

Definition
binding-protein-dependent transport systems inner membrane component
Orthology
K13891  
glutathione transport system permease protein
Organism
spe  Serratia proteamaculans
Pathway
ABC transporters
Module
Glutathione transport system
Brite
KEGG Orthology (KO) [BR:spe00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Spro_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1693294..1694202
Genome map
AA seq 302 aa AA seqDB search
MIKHWRRNAAMKAMPTINPNAVRTPWHEFWRRFRQQRVALVAGLLVLLLVVAALLAPYLV
PFDAENYFDYDRLNEGPSLVHWLGVDSLGRDIFSRILMGARISLAAGVFSVLVGGLIGTL
LGLLAGYYEGWWDRITMRICDVLFAFPGILLAIGVVAIMGSGMSNVIIAVAIFSIPAFAR
LVRGNTLVLKHLTYIESARSIGASDWTIILRHILPGTISSIVVYFTMRIGTSIITAASLS
FLGLGAQPPTPEWGAMLNEARADMVMAPHVAIFPSLAIFITVLAFNLLGDGLRDALDPKL
KG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcattggcgacgcaacgccgcaatgaaggcgatgccgacgattaaccctaac
gcggtgcgcacaccgtggcatgagttctggcggcggttccgccagcaacgtgtggcgctg
gtcgccgggctgttggtgctgttgctggtggttgccgcgttattggcaccttacctggtg
ccgtttgatgcggaaaactactttgattatgaccgcctgaacgaaggcccttcgctggtg
cactggttgggggtagattcccttgggcgagatattttcagccgcattctgatgggcgct
cgtatttcgctggccgccggggtgttctcggtgctggtcggcgggctgatcggcacgctg
ctgggcctgttggccggttattatgagggctggtgggaccgtatcaccatgcgtatctgt
gacgtgctgtttgcctttcccggtattttattggcgattggcgtggtagcgattatgggc
agcggtatgtccaacgtgatcattgcagtggcgattttcagcattccggcgtttgcccgg
ctggtacgcggcaatacgctggtattgaagcacctgacctatatcgagtcggcgcgcagc
atcggggcttccgactggaccatcatcctgcgacatatactgccggggacgatttcgtcg
attgtggtgtattttaccatgcgtatcggcacctcgatcattaccgccgccagcctgtca
ttcctcggcctgggcgcgcagccaccaacgccggagtggggtgcgatgctcaatgaggct
cgggcggacatggtgatggcaccgcacgtggcgattttccccagtctggcaatattcatc
accgtactggcgttcaacctgctgggtgacgggctgcgcgacgcgctggatccgaaatta
aaagggtag

DBGET integrated database retrieval system