KEGG   Serratia proteamaculans: Spro_1581Help
Entry
Spro_1581         CDS       T00595                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spe  Serratia proteamaculans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spro_1581
   00052 Galactose metabolism
    Spro_1581
   00500 Starch and sucrose metabolism
    Spro_1581
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_1581
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spro_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1725426..1726340
Genome map
AA seq 304 aa AA seqDB search
MWMKNMQKRLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGIKDIVL
VTHSSKNAIENHFDTSFELEAVLESRVKRQLLEEVQTICPADVTVMQVRQGQAKGLGHAV
LCAKPMVGDDPFVVLLPDVLLDDSTADLRKENLAKMIQRFTDTGFSQIMVEPVPEQDVSK
YGVVDCGGAALSAGESTPMTAVVEKPALEDAPSNLAVVGRYVLSADIWPLLEKTLPGAGD
EIQLTDAIAALMGQETVEAFHMSGKSHDCGDKLGYMKAFVQYGLRHASEGKDFTQWLKQT
LNSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgaaaaacatgcaaaaaagattgaaggctgtcattcccgtagcaggtctggga
acccgtatgttgccagcgacaaaagccatccctaaagaaatgctgccggtggtcgataaa
ccattgattcagtacattgtgaatgagtgtgtggcggctgggatcaaagatattgtgttg
gtcacccactcctccaaaaatgcgatcgaaaaccacttcgatacctcgtttgagcttgaa
gccgttttggaatcgcgcgttaagcgtcagttactggaagaagtacagactatctgcccg
gcagatgtgacagtaatgcaagtacgccagggacaagctaaaggtctggggcacgcggtt
ctgtgcgctaaaccaatggtcggcgatgatccttttgttgtgttgttacccgatgtgttg
ctggatgactcaactgccgatctgcgtaaagaaaacctggctaaaatgattcaacgtttc
actgatacaggttttagccagatcatggtggaaccggtaccggaacaggatgtttcgaaa
tacggcgtcgttgattgtggtggtgcggcgttgtcagcaggtgagagtaccccgatgacc
gccgtggtggaaaaaccggcgctggaagatgcaccttcaaatctggcggtagtgggccgt
tatgttttgtctgcggatatttggccgctgctggaaaaaaccttaccgggtgccggcgat
gaaatccagttgaccgatgccattgctgccttgatggggcaggaaaccgtagaggctttt
catatgagcggaaaatcgcatgactgcggcgataagttgggctatatgaaggcattcgta
caatacggactgcgtcacgcctccgaaggcaaagattttacccagtggctaaaacaaacg
ctgaacagcaagtaa

DBGET integrated database retrieval system