KEGG   Serratia proteamaculans: Spro_1619Help
Entry
Spro_1619         CDS       T00595                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
spe  Serratia proteamaculans
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Spro_1619
Enzymes [BR:spe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Spro_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1773902..1774834
Genome map
AA seq 310 aa AA seqDB search
MLNQPQSGNDMPRFAGIPTMMRLPVADDARGLDAAFVGIPLDIGTSNRSGTRYGPRQIRQ
ESVMIRPYNMGTAAAPFERLQVADLGDIAINPYSLEDSVRRIELAYNGILAHGCIPLTLG
GDHTLTLPVLRAMASRYGPVGLIHVDAHSDTNEEMFGEKLAHGTTFRRAFEEGLLQPQRV
IQIGLRGSGYEADDFDWSRKQGFRVVPAEACWYRSLAPLMEEVREQMGNAPVYLSFDIDG
LDPAFAPGTGTPEVGGLSVWQGLEIVRGCRGLNLVGSDVVEVSPPYDRSGNTALLAANLL
FEMLCVLPSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatcaaccccagagtggcaatgatatgccgcgttttgccggtatccctaccatg
atgcgtctgcccgttgccgacgatgcgcgagggctggatgcggccttcgtcggtattcct
ctcgatattggcacttcaaaccgcagtggcacgcgttacgggccgcggcaaatccgtcag
gaatcggtgatgatccgcccatacaacatgggcaccgctgccgcaccttttgaacggctg
caggtggccgacctgggggatatcgccatcaatccttacagcctggaagacagcgttcgt
cgcattgagttggcctataacggcattctggcccacggctgcattccactgacgctgggg
ggcgaccacacgctgacgttgcctgtgctgcgcgccatggccagccgatatggcccggtc
ggcttgattcacgtagatgctcactcagacaccaacgaagagatgtttggtgaaaagttg
gcacacggaacaactttccggcgagcctttgaagaggggctattgcagccacaacgggtc
attcagattggcctgcgcggcagcggctatgaggctgatgatttcgattggtcgcgcaag
caggggttccgcgtggtaccggcagaagcctgctggtaccgctcgttggcaccgctgatg
gaggaagtgcgcgagcagatgggcaatgcgccggtttatctcagtttcgacatcgacggc
ctggatccggcatttgcaccgggcaccggcacgccggaggtcggcgggctgtcggtctgg
cagggcctggaaattgtcagaggctgccgggggctaaacctggtcggcagcgacgtggtg
gaggtttcgccgccttacgatcgttccggcaacaccgcgctactggcggccaacctgttg
tttgaaatgctgtgtgtactgccgtcgcgataa

DBGET integrated database retrieval system