KEGG   Serratia proteamaculans: Spro_1924Help
Entry
Spro_1924         CDS       T00595                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
spe  Serratia proteamaculans
Pathway
spe00520  Amino sugar and nucleotide sugar metabolism
spe01100  Metabolic pathways
spe01501  beta-Lactam resistance
Module
spe_M00628  beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_1924
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Spro_1924
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Spro_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABV41027
JGI: Spro1924
UniProt: A8GD37
Position
2105451..2106470
Genome map
AA seq 339 aa AA seqDB search
MLDVASYELDAEEREILQHPMVGGLILFTRNFHDAQQLRELVRQIREASHDRLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALNEVHEGGRLAQEAGWLMAAEMIAQDIDISFAPVLDIG
HVSAAIGERSFHSDPQQALAMAERFILGMHSAGMKTTGKHFPGHGAVSADSHKETPRDPR
PLAEIREHDMAIFRELINRQLLDAVMPAHVIYTEADPRPASGSPYWLKQILRQELGFDGV
IFSDDLSMEGAAIMGSYAERGQAALDAGCDMILVCNNRAGAVSVLDNLSPVKAERVKRLY
HRGQFTRQELRDSARWQQAHKELNALSERWEEHKQRNAG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtcgccagctatgagctggacgcggaagaacgtgagatcctgcaacacccg
atggtgggcggcctgatcttgttcacccgcaatttccacgatgcgcaacagttgcgcgag
ctggtacgccaaatccgcgaggcttctcacgatcggctggtggtggcggtggatcaggaa
ggtggccgtgtgcagcgcttccgcgagggtttcacccgtctgccggcggcgcagtcattc
gccgcattaaacgaagtgcatgagggcgggcgtctggcacaggaggcgggctggttgatg
gcggcggaaatgatcgcgcaggatatcgatatcagttttgccccggtactggatattggc
cacgtcagtgcggcgattggcgagcgctcgttccacagcgatccgcagcaggcgctggcg
atggcagagcgcttcattctgggcatgcacagcgccgggatgaaaaccaccggcaagcat
ttccctggccacggtgccgtcagtgcggactcgcacaaagaaaccccgcgcgatccgcgt
ccgctcgctgagatccgcgaacatgatatggcgatcttccgtgaattgattaaccgtcag
ctgctcgacgccgtgatgccggcacacgtcatctatactgaagcagacccacgtcccgcc
agcggctcgccttactggctaaaacagatcctgcgtcaggaattgggctttgatggcgtt
atcttctcggacgatttgtcgatggaaggggcggcgattatgggcagttatgccgagcgc
ggccaggcagcactggatgccggttgtgacatgatcctggtgtgtaataaccgcgccggg
gcggtcagcgtgctggataacctgtccccggtcaaagcagagcgggtgaagcggttatat
catcgcggtcagttcacccgtcaggaattgcgtgattctgcgcgctggcaacaggcgcat
aaagaactgaatgcgctcagcgaacgctgggaagagcacaaacagcgtaatgccgggtga

DBGET integrated database retrieval system