KEGG   Serratia proteamaculans: Spro_1973Help
Entry
Spro_1973         CDS       T00595                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
spe  Serratia proteamaculans
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spe00052]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:spe00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2158498..2161590
Genome map
AA seq 1030 aa AA seqDB search
MNNWENIEKQSENRLPARASFFSYADARQALSLDRNASLGFQLLSGRWQFRYFEHPDLVP
EAFYRQPMAEWGEITVPGMWQMEGHGQLQYTDEGYPFPIDVPYVPTNNPAGAYQRLFTLD
NEWLDQQVIIKFDGVETYFEVYLNGHYVGFSKGSRLSAEFDLSDYLQAGDNLLSVRVLQW
ADSTYIEDQDMWWMAGIFRDVYLIGQQRTHIHDLTLVTTFDEQYCDALLAIDVELQHLGQ
GVAGGYRLQAQLFDGEACVGELWANELSIGAGATCRFEIPVSQPRQWNAEDPYLYQLLLS
LRDGDGNLLSVVPQRVGFREISVRDGLFHINGRYLKLHGVNRHDHDHRKGRAVDMARVER
DIVLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDLESHGFANVGDISRITDDPR
WENAYVERIERHVKAQKNHPSIIIWSLGNESGYGCNIRAMAKRCKALDATRLVHYEEDRD
AEVVDVISTMYSRVAMMNAFGEYPHPKPRILCEYAHAMGNGPGGLFEYQSVFNRHASLQG
HYIWEWCDHGLLSHDQQGRERYQYGGDYGDYPNNYNFCMDGLIYPDQRPGPGLREYKQVL
CPVEVSGVGEKTSVLRVKNRYWFSSLADITLKVSVKAGGRQLTGYEIKLPHLQPGESEEV
HLPALALGAEETFIDVEVYKDSATRYSESGDLLGQYQHLLQPATALISPPESIPVSALQC
ADENHQMIVSGENFSLTFSRLSGELQSWKVAGEEVVGRAPHLTFFKPVIDNHKQEYEGIW
LPNHLQIMQQHFRSLHWELQGDDVVIEVRTLIAPPVFDFGMRCRYRWQISAQGHVSLDLS
GEPYGDFQQVIPKIGLDFGLSRRFEQVEYYGRGPGENYQDSCQANLIGHYQQRVGELFEH
YPFPQDNGNRQEVRWLSLQDANGHGIFIQPRRPINFSLWPYSAEMLHQAQHINELQESDY
LTLNLDDQILGLGSNSWGSEVLDSYRVYLSSFNYGFTLVPFNRQETEAATLAGYRFSPAI
NNAQSEEANL
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaattgggaaaacatagaaaaacagtcggagaatcgcttgccggcgcgggcgagt
ttcttcagctatgcggatgccaggcaggcattgagtcttgatcgcaacgcaagtttgggc
ttccagttgctgagcgggcgttggcagtttcgctacttcgaacacccggacctggtgccg
gaggcgttttaccgccagccgatggcggaatggggcgaaatcaccgtgccgggcatgtgg
cagatggaagggcatggtcaactgcagtataccgacgaaggttacccattcccgatcgac
gtgccttatgtgccgaccaataatcctgccggggcctatcagcgcctttttactctcgat
aacgagtggctggatcaacaggtcatcatcaaatttgacggcgtggaaacctattttgag
gtttacctcaatggtcactacgtcggttttagtaaaggcagccgtctgtcagccgagttt
gatctcagcgactatctgcaagcgggggacaacctgctgtccgttcgcgtgctgcaatgg
gccgattctacctatatcgaagatcaggacatgtggtggatggccggtatcttccgcgat
gtttacctgatcggccagcaacgcacgcatattcatgatcttactttggttaccaccttt
gacgagcagtattgcgatgcgctgctggcgatagacgtcgagttgcagcatctggggcaa
ggcgtggctggcggttatcgtctgcaggcgcagctctttgacggtgaagcctgcgtcggt
gagctgtgggcgaacgaactgagcattggggcgggtgccacctgccggtttgaaattccg
gtcagccaacccaggcagtggaatgcggaagatccctatctgtatcaactgttgctcagt
ctgcgcgacggcgatggcaatctgttatcggtagtgccgcagcgggtgggtttccgtgaa
attagcgtgcgcgatgggctattccacatcaacgggcgctacctgaaactgcacggcgtt
aaccgccatgaccacgatcatcgcaaaggtcgggcggttgatatggcgcgggttgagcgc
gacatcgtgctgatgaaacagcacaacatcaactcggtgcgcaccgcccattatccgaac
gatccgcgtttttacgagctgtgcgatatctacggcctgtttgtgatggcggaaaccgat
ctggaaagccacgggtttgccaacgttggcgatatcagccgcattaccgacgatccacgt
tgggaaaacgcctacgtagaacgcattgaacgccatgtgaaggcgcagaaaaaccatcct
tcaatcattatctggtcactgggcaacgagtctggctatggctgcaacattcgcgccatg
gccaaacgctgtaaggcgctcgatgccacccgactggtgcattatgaagaagaccgggat
gcggaagtggtcgatgtgatcagcaccatgtattcccgcgtggcgatgatgaatgcgttc
ggtgagtatcctcaccccaaaccccggatcctgtgtgaatacgctcatgctatgggcaat
gggccgggcggactgttcgaatatcagtcggtgtttaaccgccatgccagcctgcaggga
cattacatctgggaatggtgcgatcacggtttgctcagccatgaccagcaggggcgggaa
cgttatcagtacggcggcgattacggcgattacccgaataactataacttctgcatggat
ggcctgatctatccggatcaacgtcctggtcccggcctgcgtgaatataaacaggtgctg
tgtccggtcgaggtgagcggcgtgggcgagaaaacgtcggtattacgggtcaaaaaccgc
tattggttcagctcgctggccgatattacgctgaaggtcagcgttaaggccggggggcgg
caactgaccggctatgagattaagctgccgcacctgcagccgggggaatcagaagaggtc
catttgcctgcattggcgctgggcgcggaagaaaccttcatcgacgtcgaagtgtataaa
gacagcgccacccgttacagcgaaagcggagatctgctggggcagtatcaacatctgttg
cagcccgccactgcgttaattagcccaccggagtccattcctgtttctgcgctgcaatgc
gctgacgaaaaccatcaaatgattgtcagtggcgagaacttcagcctgaccttctcgcgc
ctgagtggcgaactgcagtcgtggaaagtggcaggagaggaggtggtgggccgcgcaccg
cacctgactttcttcaaaccggtgatcgacaaccacaagcaggagtatgaaggcatttgg
ctgccgaaccatctgcagatcatgcagcagcatttccgtagcctgcactgggaactgcag
ggggatgacgtggtgattgaagtccgcaccctgattgccccgccggtatttgattttggc
atgcgttgccgttaccgctggcagatctctgcgcagggccatgtcagcctggatctgtcg
ggcgagccttacggcgatttccagcaggtgatcccgaagattggcctggattttggcctc
agccgccgctttgaacaggtggaatactacggccgtgggccgggggaaaactatcaggac
agctgccaggctaacctgatcggccactatcagcagcgggttggcgagctgtttgagcac
tatccgttcccgcaggataacggcaatcgccaagaggtacgctggctgagtctgcaagat
gccaatggccacggcatctttatccagccgcggcggccgatcaatttcagcctgtggccc
tacagtgccgagatgctgcaccaggctcagcatattaatgaactgcaagaaagcgactac
ctgacgttaaacctcgacgatcaaattctggggctgggctccaactcctggggttcggag
gtgctggattcctatcgggtttatctgtcgtcgtttaactacggctttacgctggtgccg
tttaaccggcaggaaaccgaggcggctacgcttgccggctatcgtttttcaccggccatt
aataacgctcagtcagaagaggcgaacttatga

DBGET integrated database retrieval system