KEGG   Serratia proteamaculans: Spro_2036Help
Entry
Spro_2036         CDS       T00595                                 

Definition
Phage-related lysozyme (muraminidase)-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spe  Serratia proteamaculans
Brite
Enzymes [BR:spe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Spro_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2231614..2231901
Genome map
AA seq 95 aa AA seqDB search
MENNAIARKSELPKLKPVEMEGLILKRLASVGQKPVADAINLGLRSLSISTLLQKLNVGD
KQNAANEFGRWVNAGGVKLNGLVMRRAAERELFLS
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatgcaatagcacgcaagtctgaactaccaaaactcaagccagttgaaatg
gaaggcttaattctcaaacgccttgcatcagttgggcaaaaaccagtggcggacgcaatt
aacctcggattgcgatcgttgagtatttcaacgctgctgcaaaaactgaatgtaggtgac
aagcagaacgctgctaatgagttcggcagatgggtgaatgctggtggcgtgaaactgaac
ggcttggtaatgcgtagggcggcagaacgtgagttgtttttgtcatga

DBGET integrated database retrieval system