KEGG   Serratia proteamaculans: Spro_2152Help
Entry
Spro_2152         CDS       T00595                                 

Gene name
btuE
Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spe  Serratia proteamaculans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Spro_2152 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Spro_2152 (btuE)
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Spro_2152 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2348419..2348970
Genome map
AA seq 183 aa AA seqDB search
MTQAIYDIPLNTIENQSTTLGKYKGSVLLVVNVASECGLTKQYAGLEALYETYRDQGFEV
LGFPSNEFLGQEPGSNEEILAFCRGTFGVEFPMFAKLEVNSENRHPLYQALIAAEPQAVT
PQDSGFLERMSSKGRAPKQTGDILWNFEKFLIGRDGNVIQRFSPDMTPEDPALVAAVKQA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagcgatttatgacattccgttgaacactatcgagaatcaatcgaccacgctg
ggcaaatataaaggcagcgtgttgctggtggtcaatgtggcttcggaatgcggcctgacc
aagcaatatgccgggctggaagccctgtacgaaacctaccgtgaccagggttttgaggta
ttgggcttcccatccaacgagttcctcgggcaggagcctggcagcaacgaagagatcctg
gcgttttgccgtggcacctttggcgttgagttcccgatgtttgccaagcttgaagtgaac
agcgaaaaccgtcatccgctgtaccaggcgctgattgccgccgaaccgcaagccgtgacg
ccgcaggacagtggattcctggagcgcatgagcagtaaaggccgggcaccgaagcaaacc
ggagacattctgtggaattttgagaaattcctgatcgggcgtgatggcaatgtgatccaa
cgtttctctccggatatgacaccggaagatcctgcgttggtggccgccgtcaaacaggcg
ttggccaagtaa

DBGET integrated database retrieval system