KEGG   Serratia proteamaculans: Spro_2171Help
Entry
Spro_2171         CDS       T00595                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spe  Serratia proteamaculans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Spro_2171
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Spro_2171
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Spro_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2368539..2369024)
Genome map
AA seq 161 aa AA seqDB search
MIHSLLSIPCVTLQGEHKTLGDFPARAYLVVNTASKCGFTPQYHGLENLWQYYRERGLMV
LGFPCNQFGAQEPGDPLEIANFCTLNYGVSFPLFSKVEVNGPGAHPLFNELKRLAPGVLG
TQRIKWNFTKFLLTADGQRVKRYAPITKPERLFDRIETLLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatccactcactgttatccatcccctgcgtcacactgcaaggggaacacaaaaccctg
ggcgatttccccgcccgggcttatctggtggtcaacaccgccagcaaatgcggatttact
cctcaatatcacgggctggaaaacctgtggcagtactatcgcgaacgcggcctgatggtg
ctgggctttccctgcaatcagttcggcgcgcaggaacccggcgatccgctggagattgcc
aacttttgcacgctgaactatggcgtcagcttcccgctattcagcaaggttgaagttaat
ggcccaggcgcgcatccgttgttcaacgaattaaaacgcctggcaccgggcgtgctgggc
actcaacgcattaaatggaacttcaccaagttcctgctgaccgctgacggccagcgggtg
aaacgctacgcgccgatcaccaaacccgaacgcctgtttgaccgcattgaaaccctgctg
aaataa

DBGET integrated database retrieval system