KEGG   Serratia proteamaculans: Spro_2258Help
Entry
Spro_2258         CDS       T00595                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spe  Serratia proteamaculans
Pathway
spe00010  Glycolysis / Gluconeogenesis
spe00030  Pentose phosphate pathway
spe00051  Fructose and mannose metabolism
spe00052  Galactose metabolism
spe00680  Methane metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
spe01230  Biosynthesis of amino acids
spe03018  RNA degradation
Module
spe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_2258
   00030 Pentose phosphate pathway
    Spro_2258
   00051 Fructose and mannose metabolism
    Spro_2258
   00052 Galactose metabolism
    Spro_2258
  Energy metabolism
   00680 Methane metabolism
    Spro_2258
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Spro_2258
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spro_2258
Protein phosphatases and associated proteins [BR:spe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spro_2258
Messenger RNA biogenesis [BR:spe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Spro_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat Init_tRNA_PT
Motif
Other DBs
NCBI-ProteinID: ABV41359
JGI: Spro2258
UniProt: A8GE19
Position
complement(2458662..2459642)
Genome map
AA seq 326 aa AA seqDB search
MKIGVVISGGDVTGINNFIFQVARLTQADIILFNGGIPGLLANHHQAISHRDLVDYAISP
MPIMSSGRTAKKLVASEYESISKQLKALHIDVLIMAGGDGSLQFLNTLSEFGVNCFGVGM
TIDNDVFGSLYSIGFSTACEQVIKEVSKLRNTGRALPGRVFMIELLGGYCGELTLQAAIK
SNADFALIPECQHALSQLADKISQRLEQQNSVIILCSEGYTKEYSPGFQGAIDTMIKQLE
PKIGVRIRKTIMGYGLRNGEPTCEEIYQGTIMASEVVRCIHSGMKNKAVIINSANQPIPI
DLISMQKRLVDTEGHHYKLARQLNII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtgtggtaataagcggcggcgacgtcaccggtatcaataactttatattc
caggtcgcgagactgacgcaggcagatatcattctgtttaacggcggaatacccggatta
ttggccaatcatcatcaagctatcagtcatcgtgacctggttgattacgctatttcacca
atgccaataatgtcttccggccgcacggccaaaaaactggtcgccagtgaatatgaaagc
atcagcaaacagcttaaggctttgcacattgatgtgcttattatggccggtggcgacggt
tcgctgcagtttttaaataccctcagtgaatttggcgttaactgttttggcgtaggcatg
accatcgacaatgatgtttttggcagcctttacagcattggtttttccaccgcctgcgaa
caggtgatcaaagaggtttccaaactgcgtaacaccggacgcgccctgcccggacgggtg
tttatgattgaactgcttggcggttactgcggggaactgacgctgcaggcggcgatcaaa
tccaatgcagactttgccctgatcccggaatgccaacatgccttaagccaactggcagat
aaaataagccagcgactggaacaacaaaatagcgttattattttatgttcagaaggctat
accaaagaatattcaccgggttttcagggtgccatcgacaccatgattaaacagcttgag
ccaaaaattggtgtgcgcatccgtaaaaccattatggggtatggcctgcgcaatggtgag
cctacctgcgaagagatttatcagggcactattatggccagcgaagtggttcgctgtatt
cactccggcatgaaaaacaaggcggtcattattaattccgctaaccaacccatccctatt
gatttaatcagcatgcaaaaacgtttggttgataccgaaggacaccattataaactcgcc
aggcaattaaatataatctga

DBGET integrated database retrieval system