KEGG   Serratia proteamaculans: Spro_2387Help
Entry
Spro_2387         CDS       T00595                                 

Definition
serralysin (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
spe  Serratia proteamaculans
Brite
Enzymes [BR:spe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Spro_2387
Peptidases [BR:spe01002]
 Metallo Peptidases
  Family M10
   Spro_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2607072..2608544
Genome map
AA seq 490 aa AA seqDB search
MDNSLNGKTSGWDDVNDLLNYHNRGNGLTLNNKPSFGVEEAGKQIARSEQTWNGIHVTGK
GATVTYSFPDWDYNQSNLNFRFGSNNQDTGLSAFTAEQKAQAKLSLQSWADVANLTFVEV
APDQKSNITFGNYEGSGQAYAIKPFSGAGNDYRGHNTDGQSWFNINYDYADPRDGVYANL
HPELGNYGRLSITHELGHTLGLDHPGKYNADENNPPNYSMANYAEDTRQFSVMSYWDESL
TGGDNGGHFAAAPLVDDIAAIQYLYGANTTTRTGDTVYGFNSNTGRDFYTLTDSNQKLVF
SVWDAGGNDTLDFSGYTQNQRINLTEGSFSDVGGLKGNVSIAVGAVIENAIGGSGNDVIV
GNDAANIIHGGAGNDVIYGGGGQDQLFGGSGKDIFVFSAVSDSSFKSPDKILDFETGIDK
IDLSFFNHGDNGAGFIHFVDAFSGQAGEALLTYDSQSNLSELALNINGQAAPDFLVNIVG
QANTATDFIV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggacaattccctaaatggaaagaccagcggttgggatgatgttaatgatttgctgaat
tatcataatagaggaaatggtttaaccctcaataataagccttcttttggtgtggaagag
gctggcaagcaaatagcgcgtagtgagcagacctggaatggcattcatgtgaccggcaaa
ggtgccaccgtcacttattcgttccctgactgggattataatcagagtaatttaaacttc
cgatttggctccaataatcaagataccggccttagcgcctttaccgcagagcaaaaggcc
caggccaagctttcgctgcaatcctgggctgatgtagctaaccttacgtttgttgaagtt
gccccggatcaaaagtccaatattaccttcggaaattatgagggttccggccaggcttat
gcaattaagccattcagcggggcgggtaacgactatcgagggcataataccgatggtcaa
agctggttcaacatcaattacgattacgcggatccccgggatggggtttacgccaatcta
caccctgagttgggcaactatggccgtttgagtatcacccatgaactggggcatacgttg
gggctggatcatccaggaaaatataatgctgatgaaaacaatccacccaactacagcatg
gcgaattacgccgaggatacgcgccaattcagcgtaatgagctattgggatgagtccctt
accggtggtgataacggcggtcattttgccgccgcgccgctggttgacgatattgccgct
attcaatatctctatggcgccaataccactacgcgcaccggggatacggtgtacgggttc
aattctaataccgggcgggatttctacacgctgacggacagtaaccagaagctggtgttc
tccgtctgggatgccggcggcaacgatacgcttgatttctcgggctatacgcaaaaccaa
cgcatcaatttgacggaaggctctttctctgacgtcggcgggttgaagggcaacgtttcc
atcgccgttggtgctgtgattgaaaatgccattggtggttcaggtaatgatgtgattgtc
ggcaatgatgcggccaatattatccatggtggtgcgggtaatgacgttatctacggtggc
ggcgggcaggatcagttattcggtggcagcggtaaagatatctttgttttctctgcggtg
agtgattcgtcgttcaaatcaccggataaaatcctggactttgaaaccggcatcgacaaa
atcgatctgtccttctttaatcatggcgacaatggcgcaggatttattcatttcgtcgac
gcgtttagcgggcaggcgggggaggcattgctaacctatgactcacaaagtaatttaagt
gagttggcgctaaatataaatggccaggcggctccggattttctggttaatattgtcggg
caagcaaatactgccactgactttattgtttaa

DBGET integrated database retrieval system