KEGG   Serratia proteamaculans: Spro_2672Help
Entry
Spro_2672         CDS       T00595                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spe  Serratia proteamaculans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Spro_2672
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spro_2672
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spro_2672
Enzymes [BR:spe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spro_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2942487..2943293
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFDRLASNKEGAFVPFVTLGDPNPALSLQIIDTLVEAGADALELGIPFSDPLAD
GPTIQSAALRAFASGVTPTQCFEMLAAIRQKHPSMPIGLLMYANLVFHKGIDAFYQRCAE
VGVDSVLIADVPYEESAPFRAAAIRHGIAPIFICPPNADDDLLREISSHGRGYTYLLSRA
GVTGTESRAQLPLHHLVNKLREYHAAPPLQGFGISEPAQVRDALQAGAAGAISGSAIVKI
IEQNHTQPAEMLTRLATFVSEMKAATRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttaccagcaactgttcgaccgcctggcaagcaacaaggaaggcgccttcgtc
ccgttcgtgaccctcggcgatcctaacccggcattgtcattgcaaatcatcgataccctg
gttgaagccggcgccgacgcgctggagttgggtatcccgttctccgatccgctggctgac
ggtccaaccattcaaagtgcggcgctgcgcgcattcgcctctggcgtcactccgactcag
tgcttcgaaatgctggccgctatccgccagaaacaccccagcatgccgatcggcctgttg
atgtacgccaatctggtgttccataaaggcatcgatgcgttttaccaacgctgtgccgaa
gtgggcgtagactcggtgctgatcgccgacgtgccgtatgaagagtctgcgcctttccgt
gccgccgctatccgccatggtatcgcgccaatctttatctgcccgcccaatgcagacgac
gatttgctgcgtgaaatctcctcacatggccggggctacacctacctgctgtcacgtgca
ggcgtaaccggaaccgaaagccgcgcccagttgccactgcatcatctggtgaacaaactg
cgtgaataccatgctgcgccaccgctgcaaggctttggtatctctgagccggcccaggtg
cgtgatgcactgcaggccggggctgccggggcgatatccggctcggcgatcgtcaagatt
atcgagcaaaaccatacgcaaccggccgaaatgctgacgcgactggcgaccttcgttagt
gaaatgaaagccgcaacccgggcataa

DBGET integrated database retrieval system