KEGG   Serratia proteamaculans: Spro_2704Help
Entry
Spro_2704         CDS       T00595                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spe  Serratia proteamaculans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Spro_2704
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_2704
   00620 Pyruvate metabolism
    Spro_2704
   00650 Butanoate metabolism
    Spro_2704
  Lipid metabolism
   00071 Fatty acid degradation
    Spro_2704
  Amino acid metabolism
   00350 Tyrosine metabolism
    Spro_2704
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Spro_2704
   00626 Naphthalene degradation
    Spro_2704
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Spro_2704
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Spro_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2978616..2981288
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEFIYNAYKDEKTCGILAEDHTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIVGWIDQPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DSGVICASEQSVIVVDSIYDAVRERFASHGGYMLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGIKVPASTKVLIGEVKLVDETEPFAHEKLSPTLAMYRAKDFADAVSKAEKLV
AMGGIGHTSCLYTDQDNQPERVAFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDVTGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPASYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYGEIAD
HLGLSAPGDRTAQKIEKLLTWLDEIKAELGIPASIREAGVTEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGRKFSEAEDEEVLVAPAAAKAEKKSKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaatgtcgctgaactgaacgagctagttgcacgtgtcaaaaaagcccag
cgcgaatatgccaacttcactcaagagcaagttgataaaatttttcgcgctgctgccctc
gccgctgccgatgcccgtattcctttggccaaactggccgttgaagaatccggtatgggt
atcgttgaagataaagtgatcaagaatcacttcgcatcagagtttatctacaacgcctat
aaagatgaaaaaacctgcggcatcctggccgaagaccatactttcggtaccatcaccatt
gcagagcctattggcctgatttgcggtatcgtgcctaccaccaacccaacttctacggcc
attttcaaagcgttaatcagcctgaaaacccgtaacggcattatcttctccccgcatcca
cgtgcgaaaaacgccaccaacaaagcagcggatatcgtgctgcaggccgcaattgccgcc
ggcgcgccaaaagacatcgtcggctggatcgaccaacctaccgttgaactgtccaaccag
ttaatgcaccaccctgacatcaacctgatcctcgcaaccggtggtccaggcatggtgaaa
gccgcctacagctccggcaaaccggcaatcggcgttggcgcaggtaacactccagttgtg
gttgacgaaactgcggatatcaaacgcgttgtcgcctcaattctgatgtctaaaaccttc
gacagcggtgtgatttgcgcctctgagcagtcggtcatcgtggttgactccatctatgat
gccgtacgcgaacgttttgccagccacggtggctacatgctgcagggtaaagaattgaaa
gccgtgcaggacatcatcctgaaaaacggcggcctgaacgcggctatcgttggccagtct
gcaccaaaaatcgctgaaatggcgggcatcaaagtgccggcaagcaccaaggtgctgatc
ggtgaagtgaaactggttgatgaaaccgagcctttcgctcacgaaaaactgtcgcctacg
ctggccatgtatcgcgccaaagactttgcagacgccgtcagcaaagcggaaaaactggtt
gccatgggcggtatcggccacacctcttgcctgtacaccgaccaggataaccagccggaa
cgcgttgccttcttcggcgacaagatgaaaaccgcacgtatcctgatcaacaccccagcg
tctcagggtggtatcggtgacctgtacaactttaaactcgctccgtctctgacgctgggc
tgcggttcctggggcggtaactccatctctgaaaacgtcggtccaaaacacctgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcataaacttccgaaatcaatc
tacttccgccgtggctcactgcctatcgcgctggaagaagtagcgaccgacggggcaaaa
cgtgccttcattgtgaccgaccgctacctgttcaataacggttatgctgaccagatcact
tccgtactcaagtcacacggcattgaaacagaagtgttctttgaagttgaagcagaccca
accctgtccatcgtgcgtaaaggcgcggagcagatgaactccttcaaaccagacgtgatt
atcgcgctgggcggtggttcaccgatggatgcggcgaaaatcatgtgggtgctgtacgaa
catcctgagacccatttcgaagacctggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagcgaaaatgatcgccgtgaccaccacctcaggt
acgggttcagaagtgacgccatttgcggtagtgaccgacgacgtgaccggccagaaatat
ccactggcggattacgctctgaccccggacatggccattgttgacgccaacctggtgatg
aacatgccaaaatccctgtgcgcctttggcggcctggatgcggtgactcacgcactggaa
gcttacgtttcagtactggcgaacgaatactctgatggccaggcgctgcaagcgttgaaa
ctgttgaaagaatatctgccagccagctataaagaaggtgccaagaacccggtcgcccgt
gagcgcgtgcacaatgccgcgaccatcgccggcatcgcgttcgccaacgccttcctgggg
gtttgccactcaatggcccacaaactgggttctgagttccacatcccacacggtctggcc
aacgccatgctgatctccaacgttattcgctataacgcgaacgacaacccaaccaagcaa
acggctttcagccagtacgaccgcccacaggctcgtcgccgctacggtgaaatcgcagac
cacctcggtctgagcgcaccgggcgaccgtaccgcgcagaaaatcgagaagttgctgacc
tggctggacgagattaaagctgaactgggcatcccggcctcaatccgtgaagccggtgtg
acagaagccgatttcctggcgaaagtcgacaaactgtctgaagacgcctttgacgaccaa
tgtaccggtgccaacccgcgttatccgctgattgccgaactcaagcaaatcatgctggat
accttctacggccgtaagtttagtgaagcggaagatgaagaagttttggtagctccagcg
gcggccaaagcagaaaaaaagtccaaaaaataa

DBGET integrated database retrieval system