KEGG   Serratia proteamaculans: Spro_2709Help
Entry
Spro_2709         CDS       T00595                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spe  Serratia proteamaculans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spro_2709
   00052 Galactose metabolism
    Spro_2709
   00500 Starch and sucrose metabolism
    Spro_2709
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_2709
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spro_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2985728..2986645)
Genome map
AA seq 305 aa AA seqDB search
MPAVNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPKGVTVMQVRQGVAKGLGHAIM
CAYPLVGDEPVAVILPDVILDEYSSDLKKDNLHEMLQRFEQTGISQIMVEPVPHKDVGNY
GVADCKGYELQPGESAPMVSVVEKPSPDEAPSNLAIVGRYVLSADIWPLLSKTPPGAGGE
IQLTDSIEMLMQQETVEAYHLKGISHDCGNKLGYMQAFVEYGMRHAGLGQEFTQWLKQLL
AADKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtaaatcgtaaagtcagaaaggctgtgatcccggttgcaggcttgggaaca
cggatgttaccggcgacaaaagccattcctaaagaaatgctgccgctggttgacaaaccc
ttgatccaatacgttgtcaatgagtgtattgcggcagggattaacgaaattgtgttggtt
acccattcctccaagaattcgatcgaaaaccatttcgataccagttttgaactggaagcg
atgctggaaaaacgagttaagcgtcagttgctcgatgaagtgcagtctatctgtcccaag
ggcgttaccgtaatgcaggtgcgtcagggggtggctaaaggcttgggtcacgcgattatg
tgtgcctatccactggtgggtgacgaaccggtggcggtgattttgccggacgtgatcctc
gatgagtacagttccgatctgaaaaaagacaatctgcacgaaatgctgcagcgctttgag
caaaccggtatcagccagattatggtggagcctgtgccgcataaagatgttggcaactat
ggcgtggccgattgcaaagggtatgagctgcagccgggcgaaagcgccccgatggttagc
gtggtagagaaaccttcgccggatgaagccccttccaacctggccattgttggccgttat
gtgctctccgccgatatctggccgctgctgtcgaaaacccctccgggtgcgggtggtgaa
atccagctgaccgacagcattgaaatgctgatgcagcaagagacggtagaggcgtatcac
ctgaaagggatcagccatgattgcggcaacaagctgggttatatgcaggcatttgtcgag
tatggcatgcgccatgccgggctgggccaagagttcactcagtggttgaaacagttactg
gccgctgataaaaaataa

DBGET integrated database retrieval system