KEGG   Serratia proteamaculans: Spro_3077Help
Entry
Spro_3077         CDS       T00595                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
spe  Serratia proteamaculans
Pathway
spe00071  Fatty acid degradation
spe00280  Valine, leucine and isoleucine degradation
spe00281  Geraniol degradation
spe00310  Lysine degradation
spe00360  Phenylalanine metabolism
spe00362  Benzoate degradation
spe00380  Tryptophan metabolism
spe00410  beta-Alanine metabolism
spe00627  Aminobenzoate degradation
spe00640  Propanoate metabolism
spe00650  Butanoate metabolism
spe00903  Limonene and pinene degradation
spe00930  Caprolactam degradation
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01212  Fatty acid metabolism
Module
spe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spro_3077
   00650 Butanoate metabolism
    Spro_3077
  Lipid metabolism
   00071 Fatty acid degradation
    Spro_3077
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spro_3077
   00310 Lysine degradation
    Spro_3077
   00360 Phenylalanine metabolism
    Spro_3077
   00380 Tryptophan metabolism
    Spro_3077
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spro_3077
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Spro_3077
   00281 Geraniol degradation
    Spro_3077
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spro_3077
   00627 Aminobenzoate degradation
    Spro_3077
   00930 Caprolactam degradation
    Spro_3077
Enzymes [BR:spe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Spro_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABV42178
JGI: Spro3077
UniProt: A8GGD8
Position
3386624..3387397
Genome map
AA seq 257 aa AA seqDB search
METPFVLRQQHQRVVTLTLHRPEARNALSTPCLEQLVYWLELADADATVGAVVITGAPRF
FAAGADLRELQKQDLPATLTDRRPLLWQRLAQFSKPLLAAVNGYALGAGCELALACDIVI
CGESARFGLPEITLGLMPGAGGTQRLIRCVGKSRASQMVLTGEAINASCALQSGLVSEVC
VDALTLERTQQVAERISLQAPLALRAAKQALKQAEETGLSQGLAIERQQFVTLAATDDRR
EGIAAFFEKRTPNYQGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccttttgtcctgcgacagcaacaccagcgagtggtgacactgacactgcat
cgcccagaggcgcgcaacgccctgagcaccccgtgcctggaacagttggtttattggctg
gaactggccgacgccgatgccaccgttggcgcagtggtgattaccggcgcgccccgcttc
tttgccgccggtgccgacctgcgcgagctgcaaaagcaagacttgcccgccacgttgacg
gatcgccgtccgctgttgtggcagcgcctggcccagttcagcaaaccgctgctggcggcg
gtcaacggctatgcgctgggtgccggttgtgaattggcattggcctgcgacatcgttatc
tgcggcgaaagcgcccgttttggcctgccggaaatcaccctcggcctgatgccaggcgcc
gggggtacccagcgtttgatccgctgcgtcggcaagtctcgcgccagtcagatggtgctg
accggtgaagccatcaacgccagttgcgcactgcaaagtggcctggtcagtgaagtctgt
gtcgatgcgctgacgctggagcgcacgcaacaggttgccgaacgcatcagcctgcaggcg
ccgctggcattacgcgccgccaagcaggcattgaaacaggctgaagaaaccggccttagc
caggggctggccatcgagcgccagcagtttgtcaccctggccgccaccgacgatcgccgt
gaaggcatcgccgccttcttcgaaaaacgtacgccaaactatcaggggcgctga

DBGET integrated database retrieval system