KEGG   Serratia proteamaculans: Spro_3378Help
Entry
Spro_3378         CDS       T00595                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
spe  Serratia proteamaculans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_3378
   01212 Fatty acid metabolism
    Spro_3378
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Spro_3378
   00650 Butanoate metabolism
    Spro_3378
  Lipid metabolism
   00071 Fatty acid degradation
    Spro_3378
   01040 Biosynthesis of unsaturated fatty acids
    Spro_3378
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Spro_3378
   00310 Lysine degradation
    Spro_3378
   00380 Tryptophan metabolism
    Spro_3378
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Spro_3378
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Spro_3378
   00281 Geraniol degradation
    Spro_3378
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Spro_3378
   00930 Caprolactam degradation
    Spro_3378
Enzymes [BR:spe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Spro_3378
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Spro_3378
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Spro_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3737751..3739916)
Genome map
AA seq 721 aa AA seqDB search
MSFENALHEQRAKPSAFQLTIRPDNIGVITIDVPGEKVNTLKAEFVEQVNDVLIRAQQHP
ALEGLVIVSGKPDSFIAGADITMIAACTTAKEAETLAKKGQSTLAQIAAFQVPVVAAIHG
ACLGGGLELALACHGRVCSLDDKTALGLPEVQLGLLPGSGGTQRLPRLIGASKALDMILT
GKHIRARQALRLGLVDDAVPQSILLQTAIERVKQGWQSRRELPWQERLLNGPLGKSLLFS
IVRKKTLAKTHGNYPAAERIIQVVRTGLDSGIASGYEAEARAFGELAMTPQSAALRSLFF
ASTALKKERGGNAQPHALHRIGILGGGLMGGGIACVTATRGGLPVRIKDVNETGINHALK
YSWDVLSKRVRSKRMRPAERQKQMMLISGSTDYSGFDQVDVVIEAVFEDLSLKQQMVAEI
EQHAAPHTIFASNTSSLPIGQIAAKAQRPEQVIGLHYFSPVDKMPLVEVIPHATTSEETI
ATTVALAHKQGKTAIVVADRAGFYVNRILAPYINEAARCLLEGEPIESLDKALVDFGFPV
GPITLLDEVGIDVGTKISPVLVEQLGPRFAAPAAFDAVLKDGRKGRKNGRGFYLYPSEGQ
QRQRHKRADTSVYILLGITPKSHLQQAVIAQRCVMMMLNEAARCLDEGVIRSARDGDIGA
VFGIGFPPFLGGPFRYMDQLGVEKVVKTLEYLQRQHGEYFAPCERLQRMAQQGERFYPQG
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaaacgcattgcacgaacagcgagccaaaccctcagcctttcagctgacg
atacgtccggacaacataggcgtgatcaccattgatgtccccggcgagaaggtcaatacg
ctgaaggccgagtttgtcgaacaggtcaacgacgtactgatccgcgcgcagcagcatcca
gcgctggaagggctggtgatcgtttccggcaagccggactcgtttattgccggtgcggat
atcaccatgattgccgcctgtaccacagccaaagaagccgaaacgctggcgaaaaaaggc
caaagcaccctggcacagattgcggcattccaggttccggtcgtggcagccattcacggt
gcctgcctgggtggcggcctggagctggctttggcctgccacggccgcgtctgctcactg
gatgataaaaccgcactcggcctgccggaagttcagttgggtttgctgccgggatccggc
ggcactcagcgcttgccgcggttgattggtgccagcaaggcgctggacatgatcctgacc
ggcaaacacattcgggcgcgccaggcgctgcgtctggggctggtggacgacgcggtgccg
caatcgatcttgctgcagaccgccatcgaacgagtcaaacagggctggcagagccgacgc
gaattgccatggcaggagcgtttgctcaacggccccttgggtaaaagcctgctgttcagc
attgtacgcaagaaaacgctggcgaaaacgcacggtaactatccggcggcggagcgcatt
attcaggtggtgcgtaccggcctggatagtggtatcgccagcggttatgaagccgaggcc
agagccttcggcgagctggctatgaccccgcagtcagcggcgttacgcagcctgttcttt
gcctctaccgcgttgaagaaagagcgcggtggcaatgcgcaacctcacgcattgcatcgt
atcggtatcctcggtggcggcttgatgggcggtgggattgcctgcgtgaccgctacgcgc
ggcggcctgccggtacgaattaaagacgttaacgaaacgggcattaaccacgcattaaaa
tacagttgggatgtgctcagcaaacgggttcgcagcaaacgcatgcgcccggcagagcga
caaaaacagatgatgttgatctccggttcgaccgattacagcggttttgatcaggtggac
gtggtgattgaggcggtgtttgaagatttgtcactcaagcagcagatggtagccgaaatc
gaacaacacgcagccccgcacactatttttgcctccaatacctcatcgctgccgattggc
cagattgccgccaaggcgcagcggccggagcaggtgatcggcctgcattatttcagcccg
gttgataaaatgccgctggtggaggtgatcccccatgccacgaccagcgaagaaaccatt
gccaccaccgtggcgttggcgcacaagcagggcaagacggcgattgtggttgccgatcgc
gccggtttctacgttaaccgcattttggctccttatataaatgaagcggcgcgttgtctg
ttggaaggtgagccgatcgaatctctggacaaggcgctggtcgatttcggcttcccggtc
gggccaataaccctgctcgatgaagtgggtattgacgtcggtaccaagataagtccggta
ctggtggagcagttgggtccgcgctttgccgccccggcggccttcgatgcggtgctgaaa
gacggacgtaaagggcgcaagaacggccgtggcttctatctgtatccgagcgaaggccag
caacgtcagcggcacaaacgcgccgatacctcggtatatattctgcttggcattacaccg
aagtcgcatttgcagcaggcggttattgcccagcgctgcgtgatgatgatgctgaacgaa
gcggcgcgctgtctggatgaaggtgtgatccgtagcgcacgcgacggtgacatcggcgca
gtgttcggtattggcttcccaccgttccttggcgggccattccgttatatggatcagctg
ggcgtcgagaaggtagttaaaacgctggagtacctgcagcgccagcacggggaatatttt
gcgccctgtgaacgtttgcagcgcatggcccagcagggcgagcgcttctatccgcagggg
tcttga

DBGET integrated database retrieval system