KEGG   Serratia proteamaculans: Spro_3407Help
Entry
Spro_3407         CDS       T00595                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spe  Serratia proteamaculans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_3407 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_3407 (glk)
   00052 Galactose metabolism
    Spro_3407 (glk)
   00500 Starch and sucrose metabolism
    Spro_3407 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Spro_3407 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spro_3407 (glk)
   00524 Butirosin and neomycin biosynthesis
    Spro_3407 (glk)
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spro_3407 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3768067..3769029)
Genome map
AA seq 320 aa AA seqDB search
MTYALVGDVGGTNARLALCTVATGEITQAKTYSGLEFDSLEAVIRQYLKDQDIQVQDACI
AIACPVTEDWVAMTNHTWAFSIKQMKASLGLSHLEVINDFTAVSMAIPMLSPEDVLQFGG
GSAQKDKPIAVYGAGTGLGVAHLVHVNRRWVSLPGEGGHVDFAPNSEEEDIILEVLRAEV
GHVSAERVLSGPGLVNLYRAIVKSDNRLPEKLEPKDITERALADSCIDCRRALSLFCVIL
GRFGGNLALNLGTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDYVHDIPVFMITH
GQPGLLGAGAHLRQTLGMHL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgccctcgtaggtgatgtaggcggcaccaatgcccgcctggcgttgtgcact
gtggcgacgggtgaaattacccaggcgaaaacctattccggcctggagtttgacagcctg
gaggcggtaatccgccaatacttaaaagatcaggatatccaggtacaggacgcctgtatt
gccattgcctgtccggtcactgaagactgggtggcgatgaccaatcatacctgggcgttt
tcgattaaacagatgaaggccagtttggggctgagccatctggaagtgatcaacgacttt
accgccgtttcgatggcgatcccgatgctgtcaccagaggatgtattgcagtttggcggt
ggtagcgcgcagaaagacaaacctattgcggtgtatggtgccgggacgggtttgggggtg
gcacatttggtgcacgttaatcgtcgctgggtgagcctgccgggcgagggcggccacgtt
gatttcgcaccgaacagtgaagaggaagatatcattctggaggtgttacgcgctgaagtg
ggccatgtgtctgccgagcgagtgctgtccgggccggggctggtcaatctttaccgcgct
atcgtcaagtccgataaccgcctgccggaaaagctggagccgaaggacattaccgagcgc
gcactggctgacagttgtatcgactgtcgccgcgccctgtcgctgttctgcgttattttg
gggcgcttcggcggcaacctggcgctgaacctcggcacctttggcggcgtttacattgcc
ggtggcatcgtgccgcgctttatggagttcttcaaagcctccggtttccgtgcggcgttc
gaggataaggggcgtttcaaggattacgtgcatgacattccggtctttatgatcacccat
ggacaacccggtttgctgggtgccggcgctcacctgcgccagacgctgggtatgcatctg
taa

DBGET integrated database retrieval system