KEGG   Serratia proteamaculans: Spro_3456Help
Entry
Spro_3456         CDS       T00595                                 

Definition
(GenBank) sulfate ABC transporter, inner membrane subunit
  KO
K02046  sulfate transport system permease protein
Organism
spe  Serratia proteamaculans
Pathway
spe00920  Sulfur metabolism
spe02010  ABC transporters
Module
spe_M00185  Sulfate transport system
spe_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Spro_3456
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Spro_3456
Transporters [BR:spe02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Spro_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABV42554
JGI: Spro3456
UniProt: A8GHG4
Position
complement(3827380..3828213)
Genome map
AA seq 277 aa AA seqDB search
MLSLTSKRVLPGFGLSLGSSLFYTCLILLLPLSALVMQLAQMSLAQYWEVISNPQVVAAY
KVTLLAAGVASLFNAVFGMLMAWILTRYRFPGRTLLDGLIDLPFALPTAVAGLTLAGLFS
TTGWYGQWLAHFDIKVTFTWLGIAVAMAFTSLPFVVRTVQPVLEELGPEYEEAAETLGAT
RWQSFRRVVIPELAPALLAGTAISFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEF
DYPAASAIASVILAASLLLLFSINVLQSRFGRRIGGH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgttgaccagcaagcgggttttacctgggtttggcctcagcctggggagcagc
ctgttttatacctgcctgatcctgctgttgccgctcagcgcgttggtgatgcagttggcg
cagatgagcctggcgcagtattgggaagtgatttccaacccgcaggtggtggcggcttat
aaggtcacgctgctggcggcgggcgttgccagcctgtttaacgcggtgttcggcatgctg
atggcctggatcctgacccgctatcgttttcccggtcgtacgctgctggacggtctgatc
gatctgccgttcgcgctgccgacggcggtagccggcctgacgctggcggggctgttttcc
accactggctggtatggccaatggctggcgcattttgacattaaggtgacgtttacctgg
ctcggcattgctgtggcgatggcctttaccagcttgccgttcgtggtacgcaccgtacag
ccggttctggaagagctggggccggaatacgaagaggcggcagaaaccctgggcgcgact
cgctggcagagttttcgtcgcgtggtgatccctgagctggcaccggcgctgttggccggt
acggcaatctcttttacccgcagcctgggcgagttcggcgcggtgatctttatcgccggc
aacatcgcctggaagacggaagtgacctcgctgatgatttttgttcgtttgcaggaattt
gattatccggcggccagtgcgattgcctcggtgatcctggcggcctcgctgctgttgctg
ttcagcattaacgttctgcagagccgctttggccgacgtatcggggggcattga

DBGET integrated database retrieval system