KEGG   Serratia proteamaculans: Spro_3456Help
Entry
Spro_3456         CDS       T00595                                 

Definition
sulfate/thiosulfate transporter subunit
Orthology
K02046  
sulfate transport system permease protein
Organism
spe  Serratia proteamaculans
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:spe00920]
Environmental Information Processing; Membrane transport; ABC transporters [PATH:spe02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3827380..3828213)
Genome map
AA seq 277 aa AA seqDB search
MLSLTSKRVLPGFGLSLGSSLFYTCLILLLPLSALVMQLAQMSLAQYWEVISNPQVVAAY
KVTLLAAGVASLFNAVFGMLMAWILTRYRFPGRTLLDGLIDLPFALPTAVAGLTLAGLFS
TTGWYGQWLAHFDIKVTFTWLGIAVAMAFTSLPFVVRTVQPVLEELGPEYEEAAETLGAT
RWQSFRRVVIPELAPALLAGTAISFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEF
DYPAASAIASVILAASLLLLFSINVLQSRFGRRIGGH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgttgaccagcaagcgggttttacctgggtttggcctcagcctggggagcagc
ctgttttatacctgcctgatcctgctgttgccgctcagcgcgttggtgatgcagttggcg
cagatgagcctggcgcagtattgggaagtgatttccaacccgcaggtggtggcggcttat
aaggtcacgctgctggcggcgggcgttgccagcctgtttaacgcggtgttcggcatgctg
atggcctggatcctgacccgctatcgttttcccggtcgtacgctgctggacggtctgatc
gatctgccgttcgcgctgccgacggcggtagccggcctgacgctggcggggctgttttcc
accactggctggtatggccaatggctggcgcattttgacattaaggtgacgtttacctgg
ctcggcattgctgtggcgatggcctttaccagcttgccgttcgtggtacgcaccgtacag
ccggttctggaagagctggggccggaatacgaagaggcggcagaaaccctgggcgcgact
cgctggcagagttttcgtcgcgtggtgatccctgagctggcaccggcgctgttggccggt
acggcaatctcttttacccgcagcctgggcgagttcggcgcggtgatctttatcgccggc
aacatcgcctggaagacggaagtgacctcgctgatgatttttgttcgtttgcaggaattt
gattatccggcggccagtgcgattgcctcggtgatcctggcggcctcgctgctgttgctg
ttcagcattaacgttctgcagagccgctttggccgacgtatcggggggcattga

DBGET integrated database retrieval system