KEGG   Serratia proteamaculans: Spro_3553Help
Entry
Spro_3553         CDS       T00595                                 

Definition
multidrug efflux system subunit MdtB
Orthology
K07788  
RND superfamily, multidrug transport protein MdtB
Organism
spe  Serratia proteamaculans
Pathway
Two-component system
Module
Multidrug resistance, efflux pump MdtABC
Brite
KEGG Orthology (KO) [BR:spe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spro_3553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3925543..3928662
Genome map
AA seq 1039 aa AA seqDB search
MQVMPPNPGGGPSRLFILRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLY
PGASPDVVTSAITAPLERQFGQMSGLKQMASQSSGGASVVTLQFQLELPLDVAEQEVQAA
INSATNLLPSDLPYPPIYSKVNPADPPILTLAVTSSAMPMTQVEDMVETRVAQKISQVTG
VGLVTISGGQRPAVRVKLNAAAVAAYGLDSETIRTAISNANVNSAKGSLDGPTRSVTLSA
NDQMKSADDYRQLIVAYQNGAAIRLQDIATIEQGAENTRLAAWANKQPAIVLNIQRQPGV
NVITTADSIREMLPQLIKSLPKSVDVKVLTDRTTTIRASVSDVQFELLLAVALVVMVIYV
FLRNVPATIIPSVAVPLSLIGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENIS
RYIEKGEKPLDAALKGAGEIGFTIISLTFSLVAVLIPLLFMGDIVGRLFREFAVTLAVAI
LISAVVSLTLTPMMCARMLSHESLRKQNRFSAASERFFDRVIARYGKWLKTVLNHPWLTL
GVAFSTLLLTVLLYLLIPKGFFPVQDNGIIQGTLEAPQSVSFSNMAERQQQVAAEILKDP
AVESLTSFVGVDGTNATLNSGRLQINLKPLSERSERIPAIITRLQQMSTQFPGVKLYLQP
VQDLTIDTQVSRTQYQFTLQAMSLDDLSLWVPKLMAELQQTPQLADVTSNWQDQGLVAYV
NVDRDSASRLGISMSDVDNALYNAFGQRLISTIYTQANQYRVVLEHDVSTTPGLAALNDI
RLTSSNGTIVPLSTIAKIEQRFGPLSVNHLDQFPAATISFNVAGNYSLGEAVDAITLAEK
NLNLPKDITTQFQGATLAFQAALGGTLWLILAAVVAMYIVLGVLYESFIHPVTILSTLPT
AGVGALLALMMAGSELDVIAIIGIILLIGIVKKNAIMMIDFALAAEREQGMTPYDAIYQA
CLLRFRPILMTTLAALLGALPLMLSTGVGAELRHPLGVCMVGGLVMSQILTLFTTPVIYL
LFDKLARNTRRQPDAQELP
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatgccacctaaccccggcggtggcccatcccgcctgtttattctgcgcccg
gtcgcgaccacgctgttgatggtggcgatcctgctggcggggattattggttatcgcgcc
ctgccggtttccgccctgccggaagttgactatccgaccattcaggtggtcacgctgtac
cctggcgccagcccggacgtggtcacttcggccattaccgccccgctggagcgccagttt
ggccagatgtccggcctgaaacagatggcatcgcaaagctccggcggcgcctcggtcgtg
acgctgcaattccagcttgagctgccgctcgacgtcgccgaacaggaagtacaggccgcg
atcaactccgccaccaacctgttacccagcgatctgccctacccgccgatttacagcaag
gttaaccctgccgatccaccgatactgacgctggccgtgacttcatccgccatgccgatg
actcaggtggaagacatggtggaaacccgcgtagcgcagaaaatatcgcaggtcaccggc
gtcgggctggtcactatctccggcggtcagcggccggcggtgcgcgtaaaacttaatgcc
gcggccgttgccgcctacggcctggacagcgaaactatccgcaccgccatcagcaatgcc
aacgtcaactccgccaaaggcagcctggatggcccgacgcgctcggtcacgctatccgcc
aacgatcagatgaagtccgccgacgattaccgccaactgattgtcgcctaccaaaacggc
gcggcgatccgcctgcaggatatcgccaccatcgaacaaggcgcagaaaatacccggctg
gcagcctgggccaataaacaaccggcgattgtgctgaacatccagcgtcagccgggggtg
aacgtgatcaccaccgccgacagcatccgcgagatgctgccccagttgatcaagagcctg
ccaaaatcggtcgacgtcaaggtactgaccgatcgcaccaccaccatccgcgcctcggtc
agcgacgtgcagttcgaactgctgttggcggtggcactggtggtgatggtgatttacgta
ttcctgcgcaacgtaccggccaccattattccgagcgtcgcggtaccgctgtcgttgatc
ggtacctttgccgccatgtacttcctcggcttttcaattaacaacctgacgctgatggca
ttgaccatcgccaccgggtttgtggtcgatgacgccatcgtggtgattgagaacatttcg
cgctatatcgaaaagggggaaaaaccgctcgatgcggcgttgaaaggggccggtgaaatc
ggcttcaccattatctcactgaccttctcgttggtggcggtgctgatcccgctgctgttt
atgggcgatatcgtcggccgactgttccgcgaatttgcggtaacgctggcggtggcgatt
ttgatttccgccgtggtttcactgacgctgacgccgatgatgtgcgcgcgcatgctgagc
cacgaatcgctgcgtaagcagaaccgtttttccgcggcttcagagcgtttctttgatcgg
gtcatcgcccgctacggcaaatggctgaaaacggtgctcaaccacccgtggctgacgctc
ggcgtggcgttcagcacgctgctgctcaccgtcttgctgtacctgctgatcccgaaaggt
ttcttcccggtgcaggacaacggcatcattcagggcacgctggaagcaccgcagtcggtg
tcgttcagcaatatggccgagcgccaacagcaggtggcagcagaaattctcaaggatccg
gcggtggaaagcctgacgtcgtttgtcggcgtcgacggcaccaacgccacgctcaacagc
ggccgtttgcagatcaacctcaagcccttaagcgaacgcagcgagcgtattccggccatc
atcacccgactgcaacagatgagtacccagttccccggtgtgaagctgtatctgcagccg
gtacaggatctgaccatcgatactcaagtcagccgcacccaataccagttcaccctgcag
gcgatgtcgctggacgatctcagtctgtgggtaccgaaactgatggcggaactgcaacaa
acgccgcagttggcggacgtgaccagtaactggcaggatcagggcctggtggcctatgtc
aatgtcgatcgcgattcggcctctcgcctcggcatcagcatgagcgacgtggataatgcg
ctgtacaacgccttcggtcagcggttgatctccaccatttacacccaggccaaccagtac
cgcgtggtgctggaacatgacgtcagcactacgccagggctggcggcgctgaacgatatc
cgtctgaccagcagcaacggcaccatagtgccactgagcaccatcgccaaaattgaacag
cgcttcgggccgctgtcggttaaccatctggatcaattcccggcggccaccatctccttt
aacgtcgcaggaaattattccctcggtgaagcggttgacgccatcactctggcagaaaaa
aacctcaacctgccgaaagacatcaccacccaattccagggcgcgacgctggcgttccag
gcagcgctgggcggcaccttatggctgatcctcgcggcagtagtcgcgatgtatatcgtg
ctgggcgtgctgtatgagagctttattcacccggtgaccattttgtccaccctgcccacc
gccggggtcggtgccttactggcgttgatgatggccggcagcgaactggacgtgattgcc
attatcggcatcatcctgctgatcggcatcgtgaagaaaaacgccattatgatgatcgac
tttgccctggccgccgagcgggaacagggaatgacgccgtatgacgcaatttatcaggcc
tgcctgctgcgttttaggccaatcctgatgaccacgctggccgcgttactgggcgcactg
ccgctgatgctcagcaccggcgtcggcgcggagctgcgccacccactcggagtctgtatg
gtcggcgggctggtgatgagccagatcctgacgttgttcaccacgccggtgatctacctg
ctgtttgacaagctggcgcgcaatacccgtcgtcagccggatgcgcaggagctgccgtga

DBGET integrated database retrieval system