KEGG   Serratia proteamaculans: Spro_3988Help
Entry
Spro_3988         CDS       T00595                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spe  Serratia proteamaculans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spro_3988
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Spro_3988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4423804..4424304
Genome map
AA seq 166 aa AA seqDB search
MIRVYIALGSNLAHPLQQVKAALEALEHLPRTRLIVCSSFYRTKPLGPQNQPDFLNAVVA
LDTLLPAEQLLDHTQAIERNQGRVRKDERWGPRTLDLDIMLYGEQVIHTDRLTVPHYGLK
EREFMLYPLAEIAPELVFPDGESLVSCLKRVPQNGMELWHQPRQKV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtttatatcgcgctgggcagcaacctggcgcacccgctacagcaggtgaaa
gccgcactggaagcgctggagcatctcccgcgcacccggttgatcgtctgttcttcgttt
taccgcaccaagccgctggggccgcagaaccagccggactttctcaatgcggtggtggca
ctggataccttgctgcccgccgaacagttactcgatcacacccaggcgattgaacgcaat
cagggccgcgtgcgcaaagatgagcgctggggcccacgcaccctcgatctggatatcatg
ctgtatggcgaacaagtgatccataccgatcgcctgacggtgccgcactacggtctgaaa
gagcgtgagtttatgctctatccgttggcagaaatcgcccccgagttagtcttcccggac
ggcgaatcgctggtcagctgcctgaagcgcgtaccgcaaaacggcatggagctttggcac
caacccaggcaaaaagtctga

DBGET integrated database retrieval system