KEGG   Serratia proteamaculans: Spro_4040Help
Entry
Spro_4040         CDS       T00595                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
spe  Serratia proteamaculans
Pathway
spe00220  Arginine biosynthesis
spe00250  Alanine, aspartate and glutamate metabolism
spe00471  D-Glutamine and D-glutamate metabolism
spe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spro_4040
   00220 Arginine biosynthesis
    Spro_4040
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Spro_4040
Enzymes [BR:spe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Spro_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABV43135
JGI: Spro4040
UniProt: A8GJ45
Position
complement(4477730..4478653)
Genome map
AA seq 307 aa AA seqDB search
MVTTLDNALLEEILQQVRPLIGQGKVADYIPALAEVASDRLAIAVCTVDGEIFQAGNATE
RFSIQSISKVLSLTLALTRYQEHEIWQRVGKEPSGLPFNSLLQLEMEQGKPRNPFINPGA
LVVCDMLQTRLSAPKQRMLEVVRQLAGEEDLAYDSRVARSEFEHSDRNAAIAYLMKSFGN
FENDVLTVLQTYFHYCALRMSCLELARSFVYLANHGRDLSGREVISPLQARQINALMMTS
GMYDGAGEFAYRVGMPGKSGVGGGIVAIVPDELSIAVWSPELDASGNSLAGTAALELLSQ
RISRSIF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtaactacattggataacgcgttgctggaagagatcctgcaacaggtgcgcccgctg
attggccagggcaaggtggcggactatattccggcgctggcggaagtggcgtccgatcgt
ctggcgatcgccgtttgcaccgtcgacggtgaaattttccaggccggtaacgccaccgag
cgcttctctattcagtccatctccaaggtgcttagcctgacgctggcgctgacacgctat
caggagcacgagatctggcagcgggtcggcaaagagccttccggtctgccgttcaactcg
ctgctgcagttggagatggagcagggcaagccgcgcaatccgtttatcaaccccggtgcg
ctggtggtgtgcgacatgctgcaaacccggctcagtgcccccaaacagcgcatgctggaa
gtggtgcgccaactggccggtgaagaagacctggcctatgattcgcgggtcgcccgttcc
gagtttgaacactccgatcgcaatgcggccatcgcctatctgatgaagtcgttcggtaac
tttgaaaacgacgtgctcaccgtgctgcaaacctatttccactactgtgcgttgcggatg
agctgcctggagctggcgcgcagctttgtctacctggccaatcacggtcgtgaccttagc
gggcgtgaagtgatcagcccactgcaggcgcgccagattaatgcgctgatgatgaccagc
ggcatgtacgacggcgcgggggaatttgcctatcgcgtgggcatgccgggcaagtccggt
gtcggcggcggtattgtcgccatcgtccccgatgagctgtcgatcgccgtctggtcgcca
gagctggatgcctccggtaactcactggcgggaactgcggcgctggaactgttgtctcaa
cggattagccgttcgattttttaa

DBGET integrated database retrieval system