KEGG   Serratia proteamaculans: Spro_4502Help
Entry
Spro_4502         CDS       T00595                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
spe  Serratia proteamaculans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_4502
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Spro_4502
Enzymes [BR:spe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Spro_4502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4989151..4990458)
Genome map
AA seq 435 aa AA seqDB search
MSTSRAQQIQQLEQEWKSARWEGITRPYSAEDVINLRGSVNPVCTLAQNGAAKLWELLHG
KSRKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANTASAMYPDQSLYPVDSVPG
VVERINNTFRRADQIQWANKIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAAD
LLTSDCDPYDREFVSGERTAEGFFRTHAGVEQAISRGLAYCPYADLVWCETSTPDLQAAK
RFADAIHAKFPGKLLAYNCSPSFNWKKNLDDQTIARFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFDAVSRGYTFASHQQEVGTGYFDKVTTIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctacctctcgtgctcaacagattcaacaactggaacaggaatggaaatcggctcgc
tgggaaggcatcacccgcccgtacagcgcggaagacgtcattaacctgcgcggttcggtt
aacccggtttgcaccctggcacagaacggtgccgccaaactgtgggaactgctgcacggt
aaatcacgcaaaggctacgtcaacagtctgggggcgctcactggcggccaggcactgcag
caggccaaggccggcatcgaggcgatttacctgtccggttggcaggtggcggcggatgcc
aacacggcgtctgcgatgtacccggaccagtcgctgtacccggttgactctgtgccgggt
gtggttgagcgcatcaacaacaccttccgccgcgccgaccagatccagtgggccaacaaa
attgagccgggcagcaaaggttacaccgactacttcctgccgatcgtcgccgatgccgaa
gccggctttggtggcgtgctgaacgctttcgaactgatgaaggcgatgattgaggccggt
gctgccggggtgcacttcgaagaccaactggcggcggtgaaaaagtgcggtcatatgggc
ggcaaagtgctggtgccaacccaggaagcgatccagaaattggttgctgcgcgcctggcg
gccgatgtgctcggcgtgccgacgttagtcatcgcacgtaccgatgccgatgccgccgat
ttactgacttctgactgcgacccgtacgaccgcgagtttgtgtccggtgagcgcactgcc
gaaggtttcttccgcacccatgccggtgtcgagcaagcgatcagccgtggcctggcatat
tgcccttacgctgacctggtgtggtgcgaaacctccacgccggatctgcaggcggccaag
cgctttgccgatgcgatccatgccaaattcccgggcaaactgctggcgtacaactgctcg
ccgtcattcaactggaaaaagaacctggacgaccagactattgctcgcttccaggaagag
ctgtcggcgatgggctacaagtaccagttcattacgctagcgggcatccacagcatgtgg
ttcaacatgtttgacctggcgcatgcctatgcacagggcgaaggcatgaaacactacgtc
gaaaaagtgcagcagccagagttcgacgcggtgtctcgcggttatacctttgcctcacac
caacaggaagtgggtaccggttacttcgacaaggtgaccaccattattcagggcggtgct
tcctcagtgacggcattgaccggttctacggaagaacagcagttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system