KEGG   Serratia proteamaculans: Spro_4503Help
Entry
Spro_4503         CDS       T00595                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
spe  Serratia proteamaculans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spro_4503
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Spro_4503
   00630 Glyoxylate and dicarboxylate metabolism
    Spro_4503
Enzymes [BR:spe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Spro_4503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4990506..4992104)
Genome map
AA seq 532 aa AA seqDB search
MTQQIVGTELTFTQGFSAAERQVLTDDAVEFLAELVSKFTPQRNKLLAARACWQQKIDQG
ERPDFISETNSIRNEKWSIRGIPEDLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVNGTISYTNEAGKIYQLKPNPAVLIARVRGLHLPEKHVQWQG
EAIPGGLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWSEVFSFAEDRFSLPRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHADRVLPDRQSV
TMDKSFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAEKNAWVLNKVRADKELEANNGH
DGTWVAHPGLADTVMEVFSRVLGERRNQLEVLRENDALISAAQLLEPCDGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKSLSDGQLVTKALFRQ
MLKEEMLVVREELGEARFNAGRFDEAARLMERITTQDELIDFLTLPGYELLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacagatagtaggcacggaattaacgtttacgcagggttttagcgctgctgaa
cgacaggtgttgacggatgacgcggtcgaattcctggcggaattggtgagtaaatttact
ccacagcgtaacaaactgttggctgcgcgtgcctgctggcagcagaagatcgatcaaggt
gaacgtccagacttcatttcggaaactaattccattcgcaatgaaaagtggtcgatccgt
ggcataccagaggatcttcgcgaccgccgggtggaaatcaccggtccggttgaacgcaag
atggtcatcaacgccctgaacgccaatgtgaaggtgtttatggcggacttcgaagactca
ctggcaccgagctgggacaaagtcatcgacggccaaatcaacctgcatgacgcggtgaac
ggcaccatctcttacaccaatgaagccggcaagatttatcagttaaagccgaacccggcg
gtattgattgctcgcgtacgcggcctgcatttgccggaaaaacacgtgcaatggcagggg
gaagcgatccccggtggcctgttcgattttgcgctgtatttcttccataactatcgtcaa
ctgctggctaaaggcagtggcccttatttctacctgccaaaaacccagtcctggcaggaa
gcggcctggtggagcgaagtcttcagctttgccgaggatcgtttctccctgccacgcggc
acgatcaaagccacggtgctgatcgaaacgctgccggcagtattccagatggacgagatc
ctctaccacctgcgcgatcatatcgtcggcttgaactgcggccgttgggattacatcttc
agctacatcaagacgctgaaaaaccatgctgaccgggtattgccggatcgtcagtcggtc
accatggacaagtcattccttagcgcctattcccgattgctgatcaagacctgccacaag
cgcggtgcctttgccatgggcggcatggcggcgtttatcccgagcaaagacgccgagaaa
aatgcctgggtgctgaacaaggtgcgggcggataaagagctggaggccaataacggccac
gacggtacctgggtggcccatccagggctggcggataccgtaatggaagtcttcagccgg
gtgctcggtgagcgccgtaaccaactcgaagtgctgcgtgaaaacgacgcgctaatcagt
gctgcgcagttgcttgaaccttgtgacggggagcgtaccgaagccggcatgcgcgccaat
atccgcgtggcggtgcagtacatcgaagcctggatctccggcaatggctgcgtcccgatt
tatggcctgatggaagacgcggcgacggcggaaatttcccgtacctctatctggcagtgg
atccaccatgaaaagagcctgagtgatggccaactggtcaccaaggcgctgttccgtcag
atgctgaaagaagaaatgctggtagtacgtgaagagttgggtgaggcacgctttaacgct
ggccgcttcgacgaagcggcacgcctgatggagcgtatcactacgcaagacgaattaatc
gatttcctgactttacctggctatgagctactggcctga

DBGET integrated database retrieval system