KEGG   Serratia proteamaculans: Spro_4647Help
Entry
Spro_4647         CDS       T00595                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
spe  Serratia proteamaculans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spro_4647
Enzymes [BR:spe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Spro_4647
Exosome [BR:spe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spro_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5132732..5134918)
Genome map
AA seq 728 aa AA seqDB search
MPVLPDRDVIDQLFSGNSADPFSLLGMHAADNGLQVRALLPDASEVWLLEQQTGRRLVQL
NCDDARGFFSATVPRRKTPFRYQFEVRWQDHQQIVDDPYRFGTLLQDIDSWLLAEGTHLR
PYERLGAHLSTLDDVEGVSFAVWAPNAQRVSVVGEFNFWDGRRHPMRLRRENGIWELFLP
GVKAGQLYKYEIIDCYGNTQLKADPYAFEAQMRPDTASLVTPLPEVVENTPQRQRANDFD
RPISIYEVHLGSWRRHTDDNFWLSYGELAVQLIDYVKDMGFTHIELLPINEHPFDGSWGY
QPLGLYAPTRRFGTPADFKDFVAAAHRAGINVILDWVPGHFPSDAYGLANFDGTALYEYA
DPREGFHQDWNTLIYNYGRHEVRNYLAGNALYWLERYGIDALRVDAVASMIYRDYSRAEG
EWVPNYYGGNENLEAIAFLRYTNQSVGKERPGAVTLAEESTDYPGVTLPPESNGLGFHYK
WNLGWMHDTLNYMQCDPVHRKYHHNQMTFGMLYAYTENFVLPISHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGCEFAQGREWNFDSSLDWHLLEGLDGWHHGVQ
RLVRDLNHCYQQQAPLYERDYRPDGFEWLVVDDHDNSVFAFARYDAHGNELIAVSNFTPV
PRHHYRIGISRPGEYREILNTDSHHYHGSNTGNQGRVVSEQIGNHGREHSISVTVPPLAT
IYLLREAQ
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtacttcccgatcgtgacgtgattgatcagcttttctccggcaattctgccgac
cccttttctctgctgggtatgcatgcggccgataacggtctgcaggtgcgtgcgctgttg
cctgatgccagcgaagtctggctgctggagcagcaaaccggccggcgtctggtgcagcta
aactgcgacgatgcgcgcggttttttcagcgccacggtaccgcgtcgcaaaaccccgttc
cgctatcaattcgaagttcgctggcaggatcatcagcagatcgtcgacgatccctaccgt
ttcggcaccctgctgcaggatattgacagttggttgctggccgaaggcacccatttgcgt
ccttatgaacgtctgggggcacacctcagtacgcttgatgacgtcgaaggcgtcagcttt
gccgtttgggcgccgaatgcccagcgcgtctcggtggttggcgagtttaacttctgggac
ggccgccgccacccgatgcgcctgcggcgtgaaaacgggatttgggagctgttcctgccg
ggggtgaaagccgggcaattgtacaagtacgaaattatagactgctacggcaatacccag
ttgaaggccgatccttacgccttcgaggcgcaaatgcggccggataccgcgtcgctggtg
acgccgttgccggaggtggtggaaaacaccccgcaacgccagcgggccaatgattttgac
cgaccgatttcgatctacgaggtgcatcttggctcgtggcggcgtcacaccgacgataat
ttctggctcagctatggcgaactggccgtgcagctgattgattacgtcaaggacatgggg
ttcacccatatcgagctgctgccgattaacgagcatccgtttgacggcagttggggctat
cagccgttggggttgtacgccccgacccggcgtttcggtaccccggccgacttcaaagat
tttgtcgcggcagcgcaccgggcgggcatcaacgtgatcctggactgggtgccggggcat
ttccccagcgatgcctatggcctggcgaatttcgacggcaccgcgctgtatgaatacgcc
gacccgcgcgaaggcttccatcaggactggaataccctgatttacaactatggccgccat
gaggtgcgtaactatctggcgggtaatgccctttactggttggaacgctatggcatcgac
gcattgcgtgtcgatgcggtggcttcgatgatctaccgcgattacagccgtgccgaaggc
gaatgggtaccgaactactacggtggcaacgaaaatctggaggccattgccttcctgcgt
tacaccaaccagagcgtcggcaaggagcggcccggtgcggtgacgctggcggaagagtcc
accgattacccaggggtaacgctgccgccggaatctaacgggctggggttccactacaaa
tggaatctgggttggatgcacgacacgctcaactacatgcaatgcgacccggtacaccgc
aagtatcatcacaatcagatgaccttcggcatgttgtacgcctacaccgaaaacttcgtg
ctgccgatttcccatgacgaagtggtgcacggcaagaaatcgattctcgaccgcatgccc
ggcgacgcctggcagaagtttgccaacctgcgtgcctactacggctttatgtgggcgcac
ccgggcaaaaaactgctgtttatgggctgcgagttcgcccaggggcgtgaatggaacttc
gacagcagcctcgactggcatctgctggaagggctggacggctggcatcacggggtgcag
cggttggtgcgcgatcttaaccattgctatcaacagcaggcgccgttgtatgagcgtgac
taccggccggacggctttgagtggctggtggtggacgaccatgacaattcggtgtttgcc
ttcgcccgctatgatgcgcatggcaatgagctgatcgctgtcagcaactttaccccggtg
ccacgtcaccactatcgcatcggaatttcccgccccggtgagtaccgggaaatcctcaat
accgactcgcaccattatcacggcagcaataccggcaaccaggggcgcgtggtgtccgag
cagataggcaaccacggccgcgagcattcgattagcgtgaccgtgccgccgctggcgacc
atctacctgctgcgggaggcgcaatga

DBGET integrated database retrieval system