KEGG   Serratia proteamaculans: Spro_4805Help
Entry
Spro_4805         CDS       T00595                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spe  Serratia proteamaculans
Pathway
spe00010  Glycolysis / Gluconeogenesis
spe00051  Fructose and mannose metabolism
spe00562  Inositol phosphate metabolism
spe01100  Metabolic pathways
spe01110  Biosynthesis of secondary metabolites
spe01120  Microbial metabolism in diverse environments
spe01130  Biosynthesis of antibiotics
spe01200  Carbon metabolism
spe01230  Biosynthesis of amino acids
Module
spe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spe_M00002  Glycolysis, core module involving three-carbon compounds
spe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spro_4805
   00051 Fructose and mannose metabolism
    Spro_4805
   00562 Inositol phosphate metabolism
    Spro_4805
Enzymes [BR:spe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spro_4805
Exosome [BR:spe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spro_4805
  Exosomal proteins of bladder cancer cells
   Spro_4805
  Exosomal proteins of melanoma cells
   Spro_4805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV43898
JGI: Spro4805
UniProt: A8GLA8
Position
5324170..5324937
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAALRNELSSVDGCGVAIAPPVMYLDQAKHALAGSRIA
LGAQNVDVNLSGAFTGEVSADMLKDIGAQYIIIGHSERRTYHKETDAAIAEKFAVLKTAG
LIPVLCIGETDAENEAGKTEEVCARQIDAVLKTQGAEAFKGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAEVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaagcttaacggcagcactcacatggttaac
gaactgatcgccgcactgcgcaatgaactgagcagtgttgacggttgtggcgtcgctatc
gcaccaccggtcatgtacctggaccaggccaagcacgcgctggccggcagccgcatcgct
ctgggcgcccaaaacgtagacgtgaacctgtccggcgcattcaccggtgaagtttccgcc
gacatgctgaaagatattggtgcgcaatacatcatcatcggccactccgagcgtcgtact
taccacaaagaaactgacgctgcgatcgccgagaaatttgccgtgctgaaaactgccggt
ctgatcccagtgctgtgcatcggtgaaactgacgctgaaaacgaagcgggtaaaaccgaa
gaagtttgcgcacgtcagatcgacgccgtactgaaaacccagggtgcagaagcctttaaa
ggcgcggttatcgcttatgagccaatttgggctatcggtaccggcaagtctgccactcct
gcgcaagcacaggcagtacacaaatttatccgcgatcacatcgccaagcaggacgcagcc
gtggctgcagaagtgatcatccagtacggcggctccgtgaacgacaaaaatgctgccgag
ctgttcactcagccggacatcgacggcgcgctggttggcggcgcatcactgaaagccgat
gctttcgccgtgatcgtcaaagccgctgctgctgctaaaaaagcctga

DBGET integrated database retrieval system