KEGG   Serratia proteamaculans: Spro_4867Help
Entry
Spro_4867         CDS       T00595                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
spe  Serratia proteamaculans
Pathway
spe00230  Purine metabolism
spe01100  Metabolic pathways
Module
spe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:spe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Spro_4867
Enzymes [BR:spe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Spro_4867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 RsgA_GTPase AAA_22 ABC_tran MMR_HSR1 Viral_helicase1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ABV43959
JGI: Spro4867
UniProt: A8GLG9
Position
5390448..5391071
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRDSRPGEQHGDHYFFVSKD
EFCQMIEQDAFLEHAEVFGNYYGTSRAAIEQVLSTGVDVFLDIDWQGAQQIRAKMPQARS
IFILPPSKDELGRRLRGRGQDSDEVIAKRMAQAVAEMAHYAEYDYLIVNDDFDLALSDLK
TIIRAERLRLGRQLLRHDALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtctctgcccccagtggcgcagggaaatcaagtctg
attcaggctttgttaaagacgcaaccgctgtacgacacgcaggtttcggtttcgcacacc
acgcgcgacagccgcccgggtgaacagcacggcgatcattatttcttcgtctcaaaagat
gaattctgccaaatgattgagcaggatgcgtttcttgagcacgcggaagtgttcggcaac
tattacgggacctcacgtgccgctattgagcaagtgttgtcgaccggcgtagacgttttc
ctggatatcgactggcagggcgcacagcaaattcgcgccaaaatgccacaggcgcgcagc
atctttattttgccgccgtcgaaggacgaacttggccgtcgcctgcgtggccgcgggcaa
gactcggatgaggtgatcgccaaacgcatggctcaggccgtggccgaaatggcacactac
gcggagtatgattatttaatcgtgaacgatgatttcgatctggccctgtccgatctgaaa
accattattcgcgccgaacgcctgcgtttaggccgccaattactgcggcatgacgcttta
atcagcaaactattggcagactga

DBGET integrated database retrieval system