KEGG   Solanum pennellii: 107027292Help
Entry
107027292         CDS       T04130                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spen  Solanum pennellii
Pathway
spen00052  Galactose metabolism
spen00500  Starch and sucrose metabolism
spen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107027292
   00500 Starch and sucrose metabolism
    107027292
Enzymes [BR:spen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107027292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357 VirDNA-topo-I_N
Motif
Other DBs
NCBI-GeneID: 107027292
NCBI-ProteinID: XP_015083954
Position
8
AA seq 652 aa AA seqDB search
MSIPNSETNNGVPYTHLPESDNDSGNTPARCRKPNKSTFIMLTGLVAFLLFFVAVKYGNN
DGTDDINPGPVPPHETVCNMLGSNLMPLTTMRTVARGVEEGVSAKSHGHFLGVRPFPWTR
KMLAWQRTSFHFQPKKNWMNDPNGPLYYKGWYHLFYQYNPEAAVWGNIVWGHAVSRDLIH
WQHLPVAMVADQWYDINGVWTGSATFLPNGDLIMLYTGSTNESVQVQNLAYPADPSDPLL
TKWIKYEGNPVLIPPPGIGLKDFRDPTTAWTTPEGKWRITIGSKINKTGISLVYDTIDFK
KFELLKGMLHGVPGTGMWECVDFYPVSKIVENGLDTSENGPAVKHVLKSSLDDDRNDYYA
LGTYNAGAGKWVPDNPIIDVGIGLRYDYGNFYASKSFYDQEKKRRVLWAWIKETDSEAAD
ICRGWSSLQPIPRTIQYDKKTGSNLITWPVAEVDNLRSNNNEFNKVVVKPGSIVPLEVGS
ATQLDIMAEFEVDQNMLKKVDGSNATYDCIKSGGSGERGALGPFGLLVLTDNSLSEQTPI
YFYIAKDLTGNFNTFFCNDLTRSSEASDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESF
AQNGRTAITSRVYPTKAIYENAKIYLFNNATDISVTATIKIWQMNSANIKSN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccctaattcagaaacaaacaacggcgttccgtacactcatttaccggagtcg
gataacgactccggcaatactcctgcaagatgccggaaacccaacaaatccacgttcata
atgttaaccggtctagtggcatttttgttattttttgtggccgtgaaatacggtaacaac
gacggtactgatgatataaatccgggaccggtaccaccgcatgaaacggtgtgcaacatg
ctcggttcgaatctaatgccgttaaccaccatgaggacggtggcgcgtggggtggaggaa
ggcgtctccgccaagtcgcacgggcattttttgggtgtacggccgtttccgtggacccga
aaaatgttggcttggcaaagaacatcattccattttcaacctaagaagaattggatgaat
gatcctaatggtccattatactacaaaggatggtatcatttgttctatcaatacaatcca
gaggcagctgtatggggaaatatcgtatggggccatgcagtctcaagagacctaatccac
tggcagcatttgccagtggctatggtagcggaccaatggtatgatattaacggtgtctgg
actggatccgctacctttttacctaatggtgaccttatcatgttatataccgggtcaacc
aacgaatcggtccaggtccaaaatcttgcgtacccggccgacccatcggaccctctatta
acaaaatggatcaagtatgagggcaacccggttctcatcccaccacccggaattgggctc
aaggacttccgtgaccccaccaccgcgtggaccacaccggaaggcaaatggcgtattact
attggttcaaaaattaataaaaccggaatctcattggtctatgacacaattgattttaaa
aaatttgaattgttgaagggtatgttacatggtgtaccgggtacgggtatgtgggaatgt
gtggatttttacccggtttctaaaattgttgaaaatgggcttgatacttcagaaaatggg
cctgcagtgaaacatgttttgaagtccagtctcgacgatgaccgaaatgactattatgcc
cttggaacttataatgcaggggcaggaaaatgggtacctgataatccaataattgatgtt
ggtattggattaagatatgattatggtaatttttatgcatcaaaatcattttatgatcaa
gaaaaaaagagaagagttctttgggcttggattaaagaaactgatagtgaagctgctgat
atttgcaggggttggtcctcacttcagccaattccaaggacgatacagtatgataagaag
acaggtagcaacttaattacatggccagtggctgaagttgataatttgagatcaaataac
aatgaatttaacaaggttgtagttaaaccaggctcaattgtccctctagaagttggttct
gccactcagttggacataatggctgaatttgaagtggatcaaaatatgttgaagaaagta
gatggaagtaatgctacatatgattgtataaagagtggtggatctggtgaacgtggtgca
ttaggaccatttggtttattagtgttaacagataatagcttatcagaacaaactccaatt
tatttctacattgctaaagatcttactggcaatttcaacacatttttctgcaatgatctc
acaaggtcatctgaagcatcagacgtacgaaaattaatctatggaagcacagttccagtt
ctccaaggagaaaaactttctctaaggacactggttgatcattcgatagtagaaagtttt
gcgcaaaatggaaggacagcaataacatcaagggtatatccgacaaaagcaatatatgaa
aatgctaagatctatttattcaataatgcaacagatattagcgttactgcaacaatcaag
atttggcaaatgaattcagcaaatataaaatctaattaa

DBGET integrated database retrieval system