KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50114Help
Entry
SpyM50114         CDS       T00497                                 

Gene name
atoB1
Definition
(GenBank) acetyl-CoA acetyltransferase 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00071  Fatty acid degradation
spf00072  Synthesis and degradation of ketone bodies
spf00280  Valine, leucine and isoleucine degradation
spf00310  Lysine degradation
spf00362  Benzoate degradation
spf00380  Tryptophan metabolism
spf00620  Pyruvate metabolism
spf00630  Glyoxylate and dicarboxylate metabolism
spf00640  Propanoate metabolism
spf00650  Butanoate metabolism
spf00900  Terpenoid backbone biosynthesis
spf01100  Metabolic pathways
spf01110  Biosynthesis of secondary metabolites
spf01120  Microbial metabolism in diverse environments
spf01130  Biosynthesis of antibiotics
spf01200  Carbon metabolism
spf01212  Fatty acid metabolism
spf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SpyM50114 (atoB1)
   00630 Glyoxylate and dicarboxylate metabolism
    SpyM50114 (atoB1)
   00640 Propanoate metabolism
    SpyM50114 (atoB1)
   00650 Butanoate metabolism
    SpyM50114 (atoB1)
  Lipid metabolism
   00071 Fatty acid degradation
    SpyM50114 (atoB1)
   00072 Synthesis and degradation of ketone bodies
    SpyM50114 (atoB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SpyM50114 (atoB1)
   00310 Lysine degradation
    SpyM50114 (atoB1)
   00380 Tryptophan metabolism
    SpyM50114 (atoB1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SpyM50114 (atoB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SpyM50114 (atoB1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SpyM50114 (atoB1)
Enzymes [BR:spf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SpyM50114 (atoB1)
Exosome [BR:spf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SpyM50114 (atoB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CAM29457
Position
131489..132673
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAHKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLIDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
cacaagattcaaacgggcaacgctgatattgttttagtcggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttgctcattgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcggcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system