KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50410Help
Entry
SpyM50410         CDS       T00497                                 

Gene name
glpO
Definition
(GenBank) alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
spf00564  Glycerophospholipid metabolism
spf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SpyM50410 (glpO)
Enzymes [BR:spf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SpyM50410 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA Pyr_redox_2 FAD_binding_3 DUF2683 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAM29753
Position
442491..444329
Genome map
AA seq 612 aa AA seqDB search
MEFSRETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAQGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KIAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKSEDFLLDDNGKIIGVKARDLLSDQEIIIKAKLVINTTGPWSDEI
RQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFDR
DENGLFTLAGGKITDYRKMAEGALTGIIQTLKEEFGKSFKLINSKTYPVSGGEINPANVD
SEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLTAAEGLSLAETLSLHYAMD
YEMALKPTDYFLRRTNHLLFMRDSLDALIDPVINEMAKHFEWSDQERVAQEDDLRRVIAD
NDLSALKGQQEG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaagagaaacaagacgcttagctctccaaaaaatgcaagaaagagattta
gacctactgattattgggggaggtattacgggtgctggtgtggcgcttcaggcggcagct
agtggcctagatacgggtctgattgagatgcaagattttgcgcaaggaacctctagccgt
tcaaccaaattggttcacggggggcttcgttatttgaaacaatttgatgtggaggtggtt
tcagatacggtgtcagagcgggctgtggtgcaacaaattgcaccccacattccaaaacca
gaccctatgttattacctgtttatgacgaacctggtagtacctttagcatgttccgtttg
aagatcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaactaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcttg
cttggtggtggggtttaccttgatttccgtaataatgacgcaaggcttgttattgaaaat
atcaaacgagctaatcgtgatggggctcttattgctagtcatgtgaaatcagaagatttc
ttgctagatgacaatggtaagattattggtgtgaaggcgcgtgatttgctgtcagatcaa
gaaatcattatcaaggctaaattagtcatcaacaccacaggtccatggagtgatgagatt
cgtcaattctctcataagggacaaccgattcatcaaatgcgccctacaaaaggggtgcat
ctggtagtggaccgtcaaaaattaccagtgtctcaacctgtctatgttgacacagggtta
aatgatggtcgtatggtctttgtcttgccacgtgaagaaaaaacttattttggaacaacg
gacacggactacactggagacttggagcacccacaagttactcaagaagatgtggattat
ttgttaggcgttgtcaataaccgctttccaaatgccaacgtgaccattgatgatattgaa
agcagttgggctggtcttcgccccttgttatcaggtaatagtgcttctgactacaatggt
ggcaacagcggtaaagtcagtgatgatagttttgatcacttggttgatactgtcaaagcc
tatattaaccacgaagatagccgagaagctgttgaaaaagctattaagcaggttgaaacc
agcacatctgaaaaagaattggatccgtctgcagtgtcacgaggttcaagttttgaccgt
gatgagaatggcctctttaccttggcaggtggtaagattaccgactatcgcaaaatggct
gaaggagcattgacagggattattcaaaccctcaaagaagagtttggcaaatccttcaag
cttatcaattcaaaaacctatcctgtttcaggaggtgaaatcaatccagccaatgtagat
tcggaaatagaagcctatgctcaattaggaactcttagtggtctttcgatggatgatgct
aggtatttggcaaacctttatggttctaatgcgccaaaagtctttgccttaactcgtcaa
ttaacagcagctgaagggttaagtttagctgaaaccttgtccttacattatgcgatggat
tatgaaatggctcttaaaccgacagattatttcttgagaagaacaaatcacctcttattt
atgcgagatagcctagatgctttgattgacccagtgattaatgaaatggctaaacatttt
gaatggtctgatcaggaaagagtggcacaagaagacgatcttcgtcgcgtgattgcagac
aatgatttgagtgccctaaaaggccagcaggagggttaa

DBGET integrated database retrieval system