KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50551Help
Entry
SpyM50551         CDS       T00497                                 

Definition
glycosyl hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpyM50551
  Lipid metabolism
   00600 Sphingolipid metabolism
    SpyM50551
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SpyM50551
Enzymes [BR:spf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SpyM50551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
575634..579050
Genome map
AA seq 1138 aa AA seqDB search
MTPDSKEQTVTGYQCHYIDQEGRKQPFNQGWRFLMADVACAQAPSFDDSNWQVIHLPHDF
SLTQPYTRNGEAESAYKLGGVGWYRHYLVLDEVLAGCHVAITFEGSYMETEIYVNGQFIG
KHLNGYQEFTYDISDVVTFGAENLLAVRVENKVPSSRWYSGSGLYREVSLSVLPQLHFVA
DQVAMTLADTAVQEKGQQKVDLRFALNQSIQTCHYQLSLCLWEQSHCSKDKKLLYQETEV
PLADLAFQRQYGLTLSLEELQLWSPDNPHLYDLELTLYYQGQVIDCFCLETGFRQLTFTA
NQGLFVNGRAVKLKGVCLHHDQGGLGACAYEDALARQLVLLKDMGANTIRSTHNPSSPKL
RQLANRLGFFVIEEAFDTWTYAKNGNVNDFSNYFHQTIGTENANYLQRVRSPETSWAQYS
IEAMVWSAKNDPSVLMWSIGNELMEGFSADVSHYPELTRQMCQWIAAIDTSRPITFGDNK
LKEADFCWHEEVSQMATLLSQLDHPQGLIGLNYANGKDYDKLHEEHSDWLLYGSETVSAI
TSRAYYKETKKVLDSGYHLTSYDHAKVDWGAFASQAWYDTITRDFVAGECVWTGFDYLGE
PTPWNKIDSGVVGLWPSPKNAYFGILDTAGFPKDSYYFYQSQWAQGQTTLHLLPVWQKDQ
LCFDEQGLVEVVVYSNAASVQLMFEDEQGNLTDYGRKAFHTYSTPTGHTYQLYQGADAAK
NPHENLYLTWRVPYQKGLLRAVAYDISGKSIPKTSGRSQVRTYGSVAKLSWKAFEAPIDA
PWELLYLDLSLLDSRGELVSHAQDWLQVQVEGPARLLALDNGNPTDHTPYQEPLRQAYGG
KLLAILALTGEAGHIKVTAKVSQQLSSVFQTQVACRAPKEHLVTLPLEKYQFKKSRLTSQ
QEIGQSCLKTTQFLSVLENKDTQQKAGKVSTPHILITSYQHYLSLPLQVCSQAFDFKKGD
DIFLPQWLQLKDAQGSFVKKAFPMTWYLKEKIFAKPILVTGYVSCFGQSIPVEARLNLAQ
ASKRRHQDLSLVAKQSLAASQKRLTYCYQYDTVQAIGAISFQNHTGTSLSVSVAISYGSQ
SSIKQETLMLADSHLSQLEEVIFFDDILTVLYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagatagcaaggagcagacagtgactggctaccaatgccactatattgatcaa
gaaggaagaaagcagccctttaatcaaggctggcgttttcttatggcagatgtggcgtgt
gctcaggccccttcttttgatgattcgaactggcaggtgattcatttaccacatgatttc
agtcttacgcagccttacacaagaaatggtgaagctgaaagtgcttataaattaggtggt
gtcggttggtatcggcattatctcgtgttagatgaggttttagctggttgtcatgttgcc
attacttttgagggttcctatatggaaacggaaatttatgttaatgggcaattcattggc
aaacacttaaatggctatcaggaatttacctatgatatctctgatgtagtgacttttgga
gctgaaaatcttctggctgtccgggttgaaaacaaggttcccagttctcgttggtattca
ggcagtggtctttatcgtgaagtgagtttgtctgttcttccccagcttcattttgtggca
gaccaggtagcaatgaccttggctgatactgctgtgcaggagaaagggcaacagaaagtt
gatttacgctttgcccttaatcagtctattcagacttgccactaccaattgagcctctgt
ttatgggaacaatcacattgctcaaaagacaaaaaactcctttatcaagaaacagaagtg
cctctagctgatttggctttccaaagacagtatggtcttacactgtctttggaagaactc
caattgtggtcaccagataatcctcacctctacgatttagaactcactctttactatcaa
ggtcaggtcattgattgcttttgccttgaaactggttttcgtcaactgacttttacggcc
aatcaggggctttttgtgaatggcagagctgtcaaattaaagggagtttgtttgcatcat
gaccaaggaggcctaggagcttgtgcttacgaagatgccctagccagacaattagtcctg
ttgaaagacatgggggctaataccattcgtagcacccataacccaagtagtcccaaactt
aggcaactagccaatcgtctcggcttttttgtgattgaagaagcctttgacacctggacc
tacgccaaaaatggaaatgttaatgacttttcaaactatttccatcagaccatcggaact
gaaaatgcaaactatcttcaaagagtgaggtcacctgaaacgagctgggcccagtatagt
attgaggccatggtctggtctgccaagaatgacccgtcagtgttgatgtggtcgattggt
aatgaattgatggaaggtttttcagccgatgtcagtcattacccagagctgacaagacaa
atgtgtcaatggattgctgctattgacacctcacgtcccattacctttggggacaataaa
ttaaaagaagctgacttttgctggcatgaggaagtgtcgcaaatggcaactcttcttagt
caattagaccatccccagggactcattgggttaaactatgctaatggaaaagactatgat
aagcttcatgaggagcactctgattggctgttgtatggttctgaaacagtctcagccatt
accagcagggcttattataaagagacaaaaaaagttcttgactccggttatcacctaacc
tcttatgatcatgctaaggttgattggggtgccttcgctagccaggcttggtatgatacc
attacccgtgattttgttgctggcgaatgcgtttggacaggctttgattatttaggagaa
cctacaccctggaacaagatcgacagcggtgttgtaggcctttggccttctcctaaaaat
gcctactttggcattttagacacggcaggctttccaaaagatagctattatttttaccaa
agtcagtgggcgcaggggcagaccaccttgcacctgttaccagtctggcagaaggaccag
ctttgtttcgatgagcagggattggtggaggttgtggtttatagcaatgctgccagtgtt
caactgatgtttgaagatgagcagggcaacttaacagattatggaaggaaggcatttcat
acttatagcacgccaacgggacacacttatcagctttaccaaggagctgacgctgctaag
aatcctcacgagaacctttacctgacttggcgagtgccctatcaaaaagggttgctaagg
gcagtggcctacgacatttctggtaaaagcattccaaaaaccagtggacgttctcaggtt
agaacctatggttcagtggcaaagctatcttggaaagcctttgaagcacctattgacgct
ccttgggaattgctttatctggatttatcactcttggatagccgaggtgaattggtcagc
catgctcaagattggttgcaggttcaagtagaaggaccagcccgtttgttggctcttgat
aatgggaatccgactgaccacaccccttatcaggagcctttgcgccaggcatatggggga
aaattattagccattttagccctcactggagaggcgggacacattaaagtcacggcaaaa
gtctcgcagcaacttagcagtgtttttcagacacaagtagcctgccgtgcccccaaagaa
cacttagtgacactacctttagagaaatatcagtttaaaaagagccgactgacaagtcaa
caagaaattggtcaatcttgtctaaagaccacacaattcctttctgttttggagaacaaa
gacacccagcaaaaagcaggtaaggttagcacacctcacattcttatcaccagttaccag
cactatttatctctgcccttgcaggtttgttctcaggcatttgattttaaaaaaggcgat
gatatcttcttgcctcagtggctccaactcaaagatgcccaaggttcttttgtgaaaaaa
gcttttccaatgacatggtacctaaaagagaaaatctttgccaagcctattcttgtcacg
ggctatgtttcttgttttggtcaatcaataccggttgaggcaaggcttaacctagcacaa
gctagcaaaagacggcaccaggatctcagtttagtcgccaagcaatccctggccgcaagt
caaaaaaggctaacttattgctaccaatatgatacggtgcaagccataggagccattagc
tttcaaaatcacacaggcacatctcttagtgtttctgtggcaatcagttatggtagtcag
agctctattaagcaagaaaccttgatgctagctgatagccacttgagccagttagaagag
gttattttcttcgatgatattttgactgttttgtatctagcagtgacccttgaagtcatt
gaaggacctgacctaactgaagacagtattcaaattggcctttgggatttagcatga

DBGET integrated database retrieval system