KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50701Help
Entry
SpyM50701         CDS       T00497                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpyM50701 (recR)
DNA repair and recombination proteins [BR:spf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SpyM50701 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
697819..698415
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDTSRDQTTILVVEDAKDVSAMEKIQEYRGYYHVLHGLISPMNGMGPD
DINLKSLITRLMDGKVSEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttatccaacacccattgcaaagttaattgacagttactctaaacttccaggaatt
ggtatcaagacggcgacgagattagccttttatactattggaatgtcaaatgaagatgtc
aatgattttgctaaaaatttattagcagctaaaagagaactgacctattgttcgatttgt
ggaaaccttaccgatgacgatccttgtcacatttgcacagacacgagccgtgatcagacg
accattctggtagtagaagatgctaaagatgtttctgccatggaaaaaatccaagagtat
cgtggctattatcatgtgcttcacggcttgatttcgcctatgaatggtatggggccagat
gacatcaaccttaaaagtttaattacccgtctaatggatggtaaggtgagcgaagttatc
gtagctaccaatgccacagcagatggggaagcaacgtccatgtatatttcacgtgtcttg
aaaccagccgggattaaggtaactcgtttggcaagaggtctcgcagtaggttcagatatt
gagtatgctgatgaagtaacattattgagagctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system