KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50780Help
Entry
SpyM50780         CDS       T00497                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM50780
Enzymes [BR:spf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SpyM50780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
779519..780919
Genome map
AA seq 466 aa AA seqDB search
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYEGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL
IVNLYHFDLPCALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEPIVPVECGY
LGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAYPRSNAPED
VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN
YYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALDLKEHY
GNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaaaacaccgttaccaatttccagatggctttttatggggaagttccaca
tctgggcctcaaagcgaaggaacggttcctggagatggcaaaggacctagcaactgggat
tactggtttagtattgagtcagctaagtttcatcaccaaattggtccagaaaaaacctca
accttttatgaaaactatgagggtgacattgcccttttgaaagaaacaggccacacgatt
tttcggacctcaatccagtggtctcgattgattccagaaggagtcggggaggttaatcca
aaggcggtgacattttaccgagaagtatttcaagacattattgctcaaggtattaaattg
attgttaacctctatcattttgatctcccctgtgccttgcaagaaaaaggtggctgggaa
aacaaagctactgtctgggcttatgaaacctacgcaaaaacctgttttgagctttttggt
gatttagtaaacacttggattacctttaatgaaccgattgttccagtcgaatgtggctat
ttaggttattatcactacccttgtaaagtagatgccaaggcagcagttcaagtggcttac
aacacacaactggccagttcactggcggtcaaagcttgtcataagcttcatcccgaccac
aagattagtattgtgcttaacatgacacctgcttatcctcggagtaatgctcctgaagat
gtcaaggctgctagaatcgcagagcttttccaaaccaaatccttcctagatccatcagtt
ttgggtgtgtacccagcagagttagtttccattttagaggaagctgatttattacctcaa
tatagtgctgatgaattagagattatcaaaaacaatactgttgattttttgggagttaat
tattatcagcctttgcgggttcaggcacctagtaagtcacagcaagagggtgaccccctt
atcttagatatttattttgaaccttatgatatgcctggtaaaaaagtcaatcctcaccgg
ggttgggaaatttatgaaccaggactttatgatattgcccttgatttaaaagaacactat
ggtaacatcgaatggctagtcacggaaaatggtatgggtgtcgaaggtgaagaagctttt
ttagcagatggccagatacaagatgactaccgcatcacctttatcgaggatcatcttatc
cagcttcataaggctttgggagaaggagccaactgcaaaggctacctcttgtggactttt
attgattgctggtcttggttaaatgcttataaaaaccgatatggtttggtagctttggat
ttagagagtcaaaagcgaaccataaaaaaatcaggttactggtttaaggcgttgagcgag
tcaaatggttttgataaatag

DBGET integrated database retrieval system