KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50804Help
Entry
SpyM50804         CDS       T00497                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SpyM50804 (malM)
Enzymes [BR:spf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SpyM50804 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
804691..806184
Genome map
AA seq 497 aa AA seqDB search
MNKRASGILMHISSLPGKFGIGTFGKSAFEFVDFLAETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFELLVADGYLQEADLVGVDFGSDPEVVDYAQIFQARRPLLEKAVQAFL
ATKEGIKELAAFEAEASWLGDFAEFMSLKEHFQNKALQEWDDRAIVKREEAALHHYRELL
AKKITYHKVCQYFFYQQWSALKIYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
KPLFIAGVPADGFSEDGQLWGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGF
SDFWEIPAGDKTARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEEQVHFVNNYLH
KHADESITKAMLRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQ
DHKDYLIYLTDLYGRAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgcaagcggtatcttaatgcatattagttccctgcctgggaaatttggg
ataggcacttttggaaaatcagcttttgaatttgttgattttctagcagagacgaaacaa
acctattggcaaattctgcctttaacaacgacgagttttggagattctccttatcagtca
ttttcagctattgctgggaacacacatttcattgattttgaattacttgttgcagacggc
tacttgcaagaagctgatctcgttggcgttgattttggttctgaccctgaggtggttgac
tatgctcagatttttcaggcaagacgccccttattagaaaaagcggtccaagcctttctt
gcaactaaagaaggcatcaaagaattggcagcttttgaagcagaagcgagttggttgggt
gactttgccgagttcatgtcattgaaagaacactttcaaaataaggccctacaagaatgg
gatgacagagcaattgtgaaacgcgaagaagcagccttgcatcattaccgtgagttgctt
gcaaaaaagattacctatcataaagtctgtcaatacttcttttaccaacaatggtcagcc
ttgaaaatttacgctaaccataaagggatagaaattattggtgatatgcctatttatgtt
tctgcggacagtgtagaagtttggacgatgcctgagctatttaaagtagatagtgataaa
aagccattgtttattgcaggtgtaccagcagatggctttagtgaagatggtcagctgtgg
ggaaatccaacctacaattggtctgctcatgaaaagtctaattttgcatggtggatttat
cgtattcaagaaagttttaaactatatgatcagctaagaatcgatcattttaaaggcttc
tcagatttttgggaaattcctgctggtgataaaactgctagaaatggccattgggcctca
gccccaggtatagcattattttctgcggttcgtgaggccttaggagagcttcctatcatc
gcagaaaaccttggttatattgatgaaaaagcagagcagctattagcatcaacaggcttt
cctggcatgaagatattagaatttggtttatttgatataacgagtcaaagtatagattta
ccacattactatgaccgtaattgtgtcgcttacacagggactcatgataacgaggtggtt
aacggatggtatgacaatcttagtgaagaacaagtacactttgtaaataactatcttcac
aaacatgcagatgaaagtattacaaaagccatgctaagaacaatctttgcttctgtttgt
gatacagccattctttgcatccaagatttattagataaagatggtaagagtcgtatgaat
atgccaaatacaattggaggtaattggcaatggcgtatgcttgacggtgaattgaaccaa
gatcacaaagattaccttatttatttaacagatctttatggtcgcgcaagataa

DBGET integrated database retrieval system