KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50812Help
Entry
SpyM50812         CDS       T00497                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpyM50812 (pfk)
   01230 Biosynthesis of amino acids
    SpyM50812 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM50812 (pfk)
   00030 Pentose phosphate pathway
    SpyM50812 (pfk)
   00051 Fructose and mannose metabolism
    SpyM50812 (pfk)
   00052 Galactose metabolism
    SpyM50812 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SpyM50812 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SpyM50812 (pfk)
Enzymes [BR:spf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SpyM50812 (pfk)
Protein phosphatases and associated proteins [BR:spf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SpyM50812 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
816081..817094
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIEKVASTIQYDFEHKGKNHHIIVLAEGVMSGEAFAQKLKEAGD
KSDLRVTNLGHILRGGSPTARDRVIASWMGSHAVELLKEGKGGLAVGIHNEELVESPILG
TAEEGALFSLTEEGKIIVNNPHKARLDFAALNRSLSQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggcggcgacgctcctggtatgaacgctgctatt
cgtgcagtcgttcgtaaagcaatttcagaaggaatggaagtttatggtatcaaccgtggc
tatgcaggtatggttgatggcgacattttcccactgggttcaaaagaagttggtgataaa
atctcacgtggtggaactttcttatactcagctcgttatccagagtttgctcaacttgaa
ggtcaattggctggtattgagcaacttaaaaaacatggtattgagggtgttgttgttatt
ggtggggatggttcttatcatggcgctatgcgcttgacagagcacggcttcccagcggta
ggtatcccaggaacaatcgataacgatattgcgggaactgactacactatcggatttgat
acagcagttaacacagcagttgaagctattgataaacttcgtgacacctcatcaagtcac
ggacgtacttttgtggttgaagtgatgggtcgcaatgcgggtgatattgctctttgggca
ggtattgctagtggtgctgatcaaatcattgttccagaagaagagtttgatattgaaaaa
gtggcatcaacaatccaatatgattttgaacacaaaggtaaaaatcaccacattatcgtc
ttagctgaaggtgttatgagtggtgaagcttttgctcaaaaacttaaagaagctggcgat
aagagtgaccttcgtgtgacaaatcttggccacattcttcgtgggggttcaccaactgct
cgtgaccgtgtcattgcttcttggatgggttcacatgctgttgagctacttaaagaaggc
aaaggtggtttggctgttggtattcacaatgaagaacttgttgaaagcccaatccttggt
actgcagaagaaggtgctttgttcagcttgactgaagaaggcaagattattgttaataat
ccacacaaagctcgtttagactttgcagctttgaaccgttcattgtcacaataa

DBGET integrated database retrieval system