KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM50999Help
Entry
SpyM50999         CDS       T00497                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:spf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1004262..1005605
Genome map
AA seq 447 aa AA seqDB search
MKMKTLLGIIAGKAAQSILTKLGRGSTYPGRLALACDKDILKDLSKDYDIVVVTGTNGKT
LTTALTVGILKETFGEIITNPSGANMITGITSTFLAAKKGKSGRQIAVLEIDEASLPRIT
TYLKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNP
VQYYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFICLNCGFKRPQLDYR
LTELTTITNHSSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKA
VFGRQETFTIGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIW
DANFELITQMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHA
YILATYTAMLEFRSLLADRHVVEKEMI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagacattactcggcattattgctggcaaagctgctcaatccattttaaca
aaactagggcgaggatctacttatcctggtcgattggctctagcttgtgataaagatatt
ttaaaggatttgtctaaagactatgatattgtggtcgtcactggtactaatggtaaaacg
ttaacaactgctcttactgtcggtattttgaaagagacatttggcgagataatcacaaat
ccaagtggtgccaatatgattactggaattacttctacttttttagctgctaaaaaaggg
aaatctggaaggcaaattgctgttttagaaattgacgaagctagtcttcctagaattacc
acttacttaaaacctagtctttttgtttatactaatatttttagggatcagatggaccgc
tacggagagatttatactacttatcagatgattgtagatggtgctcgaaatgctccaaaa
gcaactattctagccaatggagatagtcctattttctcttctaaggacatagttaatcca
gttcagtattatggttttgatactgctaagcatgctccgcagctagctcattacaacaca
gaagggattttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcg
aatctaggagactttatttgtttaaattgtggcttcaagagaccacagttggattatcga
ttaactgaactcacgacgattaccaatcacagttctgagtttatcattgatggccaagat
tacaaaatcaatgtcggtggcttatataatatttacaacgccctcgctgccgtctctgtt
gctgaatttttcggtgtttctcccgagaaaatcaaggcaggctttaacaaaagtaaggcg
gtttttggaagacaagaaacttttactattggtgataaatcatgcacccttatccttatc
aagaatcctgttggagccagtcaagcgcttgaaatgattcagctagctgattacccattt
agcttatctgtgcttttaaatgctaattacgctgacggcattgataccagctggatttgg
gatgctaattttgaactcattacccaaatgcccattacagaaattaatgctggcggcgtc
cgtcactctgaaattgctagaagacttagagttacaggatttgacgatactaagataaaa
caagctgaaaagctcgagcaaatcatagaaaccattgaaaaacaagaagctaagcatgcc
tatattttagcaacctatacggcaatgttagaattccgtagcttacttgctgaccgccat
gtcgttgaaaaggagatgatctaa

DBGET integrated database retrieval system