KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51119Help
Entry
SpyM51119         CDS       T00497                                 

Gene name
dfrB
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SpyM51119 (dfrB)
   00670 One carbon pool by folate
    SpyM51119 (dfrB)
Enzymes [BR:spf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SpyM51119 (dfrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1117808..1118305)
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLSQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagactttctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttatttcgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgaccaaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system