KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51354Help
Entry
SpyM51354         CDS       T00497                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpyM51354 (tpiA)
   01230 Biosynthesis of amino acids
    SpyM51354 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM51354 (tpiA)
   00051 Fructose and mannose metabolism
    SpyM51354 (tpiA)
   00562 Inositol phosphate metabolism
    SpyM51354 (tpiA)
Enzymes [BR:spf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SpyM51354 (tpiA)
Exosome [BR:spf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SpyM51354 (tpiA)
  Exosomal proteins of bladder cancer cells
   SpyM51354 (tpiA)
  Exosomal proteins of melanoma cells
   SpyM51354 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1345212..1345970)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
AGSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgacgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctggtagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system