KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51761Help
Entry
SpyM51761         CDS       T00497                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpyM51761 (ruvA)
Enzymes [BR:spf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SpyM51761 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1759768..1760364)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYKATELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaactggtaactatttacctgcatcaagtgattcgtgaggatgctcacttgttgttt
gggtttcatacggaagacgaaaaagatgtttttctgaaattaatttctgtatcaggcatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaagcaacagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system