KEGG   Streptococcus pyogenes Manfredo (serotype M5): SpyM51826Help
Entry
SpyM51826         CDS       T00497                                 

Gene name
hasC1
Definition
UTP--glucose-1-phosphate uridylyltransferase 1 (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spf  Streptococcus pyogenes Manfredo (serotype M5)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spf00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spf00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spf00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spf00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1823999..1824913
Genome map
AA seq 304 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDKMHASTIAVMKVPHEDVSSYGVIAPQG
KAVKGLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQVPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSKVP
THSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgctgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagagtacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaggactatgacaagatgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgcccctcaaggc
aaggctgtcaagggcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggtccctggagcaggtaacgaagtgcaactcacagatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaatttaaaggcaatcgttacgatgttggg
gataaatttggattcatgaaaacatctatcgactatgccttagaacacccacaggtcaaa
gaggacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtaaagtacca
acacattcaaagtaa

DBGET integrated database retrieval system