KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0170Help
Entry
SpyM3_0170        CDS       T00089                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:spg00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200131..201576
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNESGIYKWADMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFSR
EQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETVYALCKPFLEEAGRLTEKAEK
LVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVSTVLQAFKAKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHIKNM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgttatgcaccaagtccaacagggcttttacatatcggg
aatgcccgcacagccctatttaattacctttatgcccgtcgtcacggaggtacttttatc
attcgtattgaagatactgaccgtaaacgtcatgttgaagatggtgaacgttctcaactt
gaaaacctaaaatggttaggaatggattgggatgaaagcccagaaacgcatgaaaattac
cgccagtctgaacgtctagcactttatcaacaatatattgatcaattgttagctgaagga
aaagcctataagtcttacgtgactgaggaagaattggcagcagagcgtgaacgccaagaa
gcagctggcgaaacgcctcgctatatcaatgaatttattggtatgtcagctgacgaaaaa
gctaagtacattgctgagcgtgaagcagcaggtatcgttccaacagtccgtcttgctgtt
aatgagtccggtatttacaaatgggctgacatggttaaaggcgatatcgagtttgaaggt
ggtaacatcggtggtgactgggttattcaaaagaaagatgggtacccaacttataacttt
gccgttgttgttgatgatcatgatatgcaaatttctcacgttatccgtggcgatgaccat
attgccaatacgccaaaacaattgatggtctatgaagctcttggctgggaagcgccagag
tttggtcatatgactcttatcatcaattctgaaacgggtaaaaaattatcaaaacgcgac
accaataccctccaattcattgaagattaccgcaaaaaaggttatatgcctgaagctgtc
tttaacttcatcgcccttcttggctggaatcctggcggagaagaggaaatcttctctcgt
gagcaactgattgccctttttgatgaaaatcgccttagcaagtcgccagctgcctttgac
cagaagaaaatggattggatgagcaatgagtatcttaaacatgcggattttgaaacagtt
tatgccctctgcaaacctttccttgaagaggcaggccgtttgacagaaaaagctgagaag
ctagtagaattatacaaacctcaattaaaatctgcagatgagattattccattgactgac
cttttcttttctgatttccctgaattaacagaagccgaaaaagaagtgatggcaggtgaa
acagtttcgacagtcttgcaagctttcaaggctaagttggaagctatgtcagatgaagac
ttcaaaccagaaaatattttcccacaaattaaggctgttcaaaaagaaacaggaatcaaa
gggaaaaacctctttatgcctattcgtattgcagtatctggtgaaatgcatggcccagaa
ttaccaaatacgatttatttattgggacgtgataaatccattgagcacatcaaaaacatg
ctataa

DBGET integrated database retrieval system