KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0347Help
Entry
SpyM3_0347        CDS       T00089                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:spg03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385973..386800
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLETLVLGQEIVAVTLKVPKMVKTDLETFALTLPGQIIQSVGRRGKYL
LIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAK
SQLSAFFAKRKLGPEPKKETFKLKTFEAALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLW
AAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVY
GQTGKSCPRCGQAIVKLKVGGRGTHICPKCQKKRP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggtccgacgagggcttgagactttagtgcttggc
caagaaattgtggctgttacgcttaaagtgccaaaaatggttaaaaccgacttagagacg
tttgccctgaccctacctggtcaaatcattcagtcagttggccgtcggggaaaatattta
ttaattgatttggggcaattagtgttggtatcacatttgcggatggaaggcaaatatttg
ctttttccagatgaggtccctgataacaaacactttcatgtcttttttgaattgaaaaat
ggttcgaccttggtttaccaagatgtgcgtaaatttggaacctttgatttgatagcaaaa
tctcaattatcagcgttttttgccaaacgaaaactaggccctgaaccaaagaaagagacc
tttaagttaaaaacctttgaggctgctttgctatcctcccaaaaacccataaaaccacat
ctgttagaccagaccttggttgctggtttagggaatatttatgtggacgaggtactttgg
gctgctaaggttcatccagaaactgcgtcttctaggttgaataaggcggagataaaacgg
ctgcatgatgaaaccatacgaatcctagctttaggaattgaaaagggcggttcgaccgtc
cgtacttaccgtaatgctttgggagctgatggcactatgcaggactatttgcaggtttat
ggtcaaactgggaaatcgtgtcctcgttgtggacaggctattgtcaaattaaaagttgga
ggaagggggacgcacatttgtccaaaatgccagaaaaaaagaccatga

DBGET integrated database retrieval system