KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0460Help
Entry
SpyM3_0460        CDS       T00089                                 

Gene name
aspC
Definition
aspartate aminotransferase (EC:2.6.1.1)
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505755..506948
Genome map
AA seq 397 aa AA seqDB search
MPKLSKRVLEMKESVTLAAGARAKALKAQGRDVLNLTLGEPDFFTPKHIQDKAIESIQNG
TASFYTNASGLPELKAAIATYLKNQYGYHLSPDQIVAGTGAKFILYAFFMAVLNPGDQVL
IPTPYWVSYSDQVKMAEGQPIFVQGLEENQFKVTVDQLERARTSKTKVVLINSPSNPTGM
IYGAEELRAIGEWAVHNDILILADDIYGSLVYNGNQFVPISTLSEAIRRQTITVNGVAKS
YAMTGWRVGFAAGEPEIISAMSKIIGQTTSNLTTVSQYAAIEAFCGSQSSLEEMRLAFEE
RLNITYPLLCQVPGFEVVKPQGAFYFFPNVKKAMEMTGFSDVTSFANAILEEVGLAVVSG
AGFGAPENVRLSYATDIKTLKEAVRRLHVFMESNEIN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactatcaaagcgagttttagaaatgaaagagagtgttactctggctgcaggt
gctagagctaaggctttgaaagcgcagggccgtgatgtactgaatttaactttaggagaa
ccagatttttttacacctaagcacattcaagacaaggcgattgaatctattcaaaatggt
acggctagcttttatacaaatgcttctgggcttccagaattaaaagctgcgattgccaca
tacctgaaaaatcagtatgggtatcacttgtctcctgatcagattgtggcaggaacaggt
gccaagttcatcctttatgccttttttatggctgttttaaatcctggtgaccaagttctc
attccaacaccatattgggtatcttattctgaccaagtaaaaatggcagaaggtcagccg
atcttcgttcaaggactagaagaaaatcaattcaaggtaactgttgaccagctggaaaga
gcaaggacaagtaagactaaagttgtccttatcaattctccttccaatccaacagggatg
atttatggtgctgaggaattaagggccattggagaatgggcggtgcacaacgatattctt
attctggcagatgatatttacgggtccttagtctataacggcaatcagtttgttcctatt
tcaacactctcagaagcgattcgtcgtcaaaccattacggtcaatggcgtggctaaaagt
tatgccatgacaggctggcgggttggttttgcagcaggtgaaccagagatcatttcggca
atgagtaagatcatcgggcagactacctctaacctgacaaccgtttcacaatatgctgct
atcgaggctttctgtggtagtcagtcatcacttgaagagatgcgattagcatttgaagag
cgccttaatatcacttatccattgttgtgtcaggtccctgggtttgaggttgttaaacca
caaggagctttttacttctttccaaacgttaagaaagccatggaaatgacaggtttttcc
gatgtgacaagctttgccaatgctattttagaggaagtcggattagctgttgtgagtgga
gcaggctttggcgcaccggaaaatgttcgtctgagttatgctacagatatcaaaaccctt
aaagaagctgttcgtagactgcatgtctttatggaaagtaatgaaattaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system