KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0663Help
Entry
SpyM3_0663        CDS       T00089                                 

Gene name
acoC
Definition
(GenBank) putative dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00010  Glycolysis / Gluconeogenesis
spg00020  Citrate cycle (TCA cycle)
spg00620  Pyruvate metabolism
spg01100  Metabolic pathways
spg01110  Biosynthesis of secondary metabolites
spg01120  Microbial metabolism in diverse environments
spg01130  Biosynthesis of antibiotics
spg01200  Carbon metabolism
Module
spg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM3_0663 (acoC)
   00020 Citrate cycle (TCA cycle)
    SpyM3_0663 (acoC)
   00620 Pyruvate metabolism
    SpyM3_0663 (acoC)
Enzymes [BR:spg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SpyM3_0663 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 PLA2_B
Motif
Other DBs
NCBI-ProteinID: AAM79270
UniProt: A0A0H2UUS8
Position
725443..726852
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPAVAPKENVASPAPQV
AATAIPQGNGGKVRATPAARKAAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVDLPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctgggcgttgacatgcaagaaggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatatccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgtgctattgaaaattgtc
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagagggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagacgctggaccagcagttgctccaaaagaaaatgtggcaagtccagctcctcaagtg
gcagcgacagctattccgcaaggaaatggcggaaaagttcgtgctactccagctgcacgt
aaggcagcagcagaaatgggcattgaccttggccaagttccaggaacaggaccaaaagga
cgtgtccataaagaagacgttgaaaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaattgcagcagacaaaggtattgatttggcaaccgtatcaggtactggcttt
aacggtaaggtcatgaaagaagatatcatggctattcttgaagcggctaaaccagctgaa
gcaaaagccccagcagctaaagaagaaaaagttgttgatcttccagaaggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gctcctacctttacgcttaactacgatattgacatgacagagatgattgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaaccttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaatgatgctaatgatattgaattacaccgctttgtgaaccttggtattgccgtaggt
cttgatgatggtcttatcgttcctgttatccatggggctgacaagatgagcttgtcagat
tttgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctctatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcaatgtgcctaaccatc
gaccaccgtttagttgatggtatgaacggtgcaaaattcatggttgatctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system