KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0663Help
Entry
SpyM3_0663        CDS       T00089                                 

Gene name
acoC
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SpyM3_0663 (acoC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM3_0663 (acoC)
   00020 Citrate cycle (TCA cycle)
    SpyM3_0663 (acoC)
   00620 Pyruvate metabolism
    SpyM3_0663 (acoC)
Enzymes [BR:spg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SpyM3_0663 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725443..726852
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKIV
RPAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPAVAPKENVASPAPQV
AATAIPQGNGGKVRATPAARKAAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVDLPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLIVPVIHGADKMSLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVARPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctgggcgttgacatgcaagaaggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatatccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgtgctattgaaaattgtc
cgtccagctggtgatactgtacctgtaactgaagttatcggttacattggtgcagagggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagacgctggaccagcagttgctccaaaagaaaatgtggcaagtccagctcctcaagtg
gcagcgacagctattccgcaaggaaatggcggaaaagttcgtgctactccagctgcacgt
aaggcagcagcagaaatgggcattgaccttggccaagttccaggaacaggaccaaaagga
cgtgtccataaagaagacgttgaaaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaattgcagcagacaaaggtattgatttggcaaccgtatcaggtactggcttt
aacggtaaggtcatgaaagaagatatcatggctattcttgaagcggctaaaccagctgaa
gcaaaagccccagcagctaaagaagaaaaagttgttgatcttccagaaggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gctcctacctttacgcttaactacgatattgacatgacagagatgattgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagcttcacagacttgatt
ggtatggcagtggttaaaaccttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaatgatgctaatgatattgaattacaccgctttgtgaaccttggtattgccgtaggt
cttgatgatggtcttatcgttcctgttatccatggggctgacaagatgagcttgtcagat
tttgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctctatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgttgcccgtccaattatggcaatgtgcctaaccatc
gaccaccgtttagttgatggtatgaacggtgcaaaattcatggttgatctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system