KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0668Help
Entry
SpyM3_0668        CDS       T00089                                 

Gene name
murC
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:spg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(733974..735311)
Genome map
AA seq 445 aa AA seqDB search
MKTLLGIIAGKAAQSILTKLGRGSTYPGRLALACNKDILKDLSKDYDIVVVTGTNGKTLT
TALTVGILKEAFGEIITNPSGANMITGITSTFLAAKKGKSERQIAVLEIDEASLPRITTY
LKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNPVQ
YYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFVCLNCQFQRPTLDYQLT
ELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKAVF
GRQETFTIGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIWDA
NFELITHMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHAYI
LATYTAMLEFRSLLADRHVVEKEMI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattactcggcattattgctggcaaagctgctcaatccattttaacaaaacta
gggcgaggatctacttatcctggtcgattggctctagcttgtaataaagatattttaaag
gatttgtctaaagactatgatattgtggtcgtcactggtactaatggtaaaacgttaaca
actgctcttactgtcggtattttgaaagaggcatttggcgagataatcacaaatccaagt
ggtgccaatatgattactggaattacttctacttttttagctgctaaaaaagggaaatct
gaaaggcaaattgctgttttagaaattgacgaggctagtcttcctagaattaccacttac
ttaaaacctagtctttttgtttatactaatatttttagggatcagatggaccgctacgga
gagatttacactacttatcagatgattgtagatggtgctcgaaatgctccaaaagcaact
atcctagccaatggagatagtcctattttctcttctaaggacatagttaatccagttcag
tattatggttttgatactgctaagcatgctccgcagctagctcattacaacacagaaggg
attttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcgaatcta
ggagactttgtttgcttaaactgtcagttccaaagaccaacgttagattatcaattaact
gagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaactacaag
ataaatgttggtggtctttataatatttacaatgcgcttgctgccgtctctgttgctgaa
tttttcggtgtttctcccgagaaaatcaaggcgggctttaacaaaagtaaggcggttttt
ggaagacaagaaacttttactattggtgataaatcatgcacccttatccttatcaagaat
cctgttggagccagtcaagcgcttgaaatgattcagctagctgattacccatttagctta
tctgtgcttttaaatgctaattatgctgacggcattgataccagctggatttgggatgct
aattttgaactcattacacacatgcccattacagaaattaatgctggcggcgtccgtcac
tctgaaattgctagaagacttagagtcacaggatttgacgatactaaaataaagcaagct
gaaaagctcgagcaaatcatagaaactattgaaaaacaagaagctaagcatgcctatatt
ttagcaacctatacagcaatgttagaattccgtagcttacttgctgaccgccatgtcgtt
gaaaaggagatgatctaa

DBGET integrated database retrieval system