KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0668Help
Entry
SpyM3_0668        CDS       T00089                                 

Gene name
murC
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SpyM3_0668 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SpyM3_0668 (murC)
Enzymes [BR:spg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SpyM3_0668 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(733974..735311)
Genome map
AA seq 445 aa AA seqDB search
MKTLLGIIAGKAAQSILTKLGRGSTYPGRLALACNKDILKDLSKDYDIVVVTGTNGKTLT
TALTVGILKEAFGEIITNPSGANMITGITSTFLAAKKGKSERQIAVLEIDEASLPRITTY
LKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNPVQ
YYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFVCLNCQFQRPTLDYQLT
ELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKAVF
GRQETFTIGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIWDA
NFELITHMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHAYI
LATYTAMLEFRSLLADRHVVEKEMI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattactcggcattattgctggcaaagctgctcaatccattttaacaaaacta
gggcgaggatctacttatcctggtcgattggctctagcttgtaataaagatattttaaag
gatttgtctaaagactatgatattgtggtcgtcactggtactaatggtaaaacgttaaca
actgctcttactgtcggtattttgaaagaggcatttggcgagataatcacaaatccaagt
ggtgccaatatgattactggaattacttctacttttttagctgctaaaaaagggaaatct
gaaaggcaaattgctgttttagaaattgacgaggctagtcttcctagaattaccacttac
ttaaaacctagtctttttgtttatactaatatttttagggatcagatggaccgctacgga
gagatttacactacttatcagatgattgtagatggtgctcgaaatgctccaaaagcaact
atcctagccaatggagatagtcctattttctcttctaaggacatagttaatccagttcag
tattatggttttgatactgctaagcatgctccgcagctagctcattacaacacagaaggg
attttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcgaatcta
ggagactttgtttgcttaaactgtcagttccaaagaccaacgttagattatcaattaact
gagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaactacaag
ataaatgttggtggtctttataatatttacaatgcgcttgctgccgtctctgttgctgaa
tttttcggtgtttctcccgagaaaatcaaggcgggctttaacaaaagtaaggcggttttt
ggaagacaagaaacttttactattggtgataaatcatgcacccttatccttatcaagaat
cctgttggagccagtcaagcgcttgaaatgattcagctagctgattacccatttagctta
tctgtgcttttaaatgctaattatgctgacggcattgataccagctggatttgggatgct
aattttgaactcattacacacatgcccattacagaaattaatgctggcggcgtccgtcac
tctgaaattgctagaagacttagagtcacaggatttgacgatactaaaataaagcaagct
gaaaagctcgagcaaatcatagaaactattgaaaaacaagaagctaagcatgcctatatt
ttagcaacctatacagcaatgttagaattccgtagcttacttgctgaccgccatgtcgtt
gaaaaggagatgatctaa

DBGET integrated database retrieval system