KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0759Help
Entry
SpyM3_0759        CDS       T00089                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813821..814423
Genome map
AA seq 200 aa AA seqDB search
MKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGK
DPKEEFTAVFKEHHEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLARA
VEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTAR
GLYKESRAERQEVISLMTKD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaaaaagca
gaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaaggtctt
cttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactgggaaaa
gatcctaaagaggaatttacggctgtctttaaagaacaccatgaggatgtggtgattgtc
aaagacattagtttttattctgtatgtgagcaccacttagttcctttttatggcaaggct
catatcgcttacttaccaagtgatggtcgagtaacaggtttgagtaaattagcgcgagca
gttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaatagcggat
gctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagagcacatg
tgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccactgccaga
ggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgacaaaagat
tag

DBGET integrated database retrieval system